KEGG   Meiothermus ruber DSM 1279: Mrub_1797Help
Entry
Mrub_1797         CDS       T01193                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mrb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1847850..1848431
Genome map
AA seq 193 aa AA seqDB search
MVRYLKGTVLKKSPSSVVLLVGGVGLEASCPASTLAQLSEGQEAALHTKLVVREDDLSLF
GFADERSLELFELLLSVSGVGPKVALNLLSSQTPALLARALAEGDLRLLTAAQGVGKKLA
ERIALELRGKVPAHLMGEGGRLVHSSQTEEAELALITLGFREGQVRSIVAEIAQKNPGAG
TQELIKLALKALR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtggttcgctacctcaagggaacggtactgaagaaaagccccagcagtgtggtcttgctg
gtggggggggtgggcctcgaggcgagctgtccggcctcgacgctggcccagctcagcgag
ggccaggaagccgctttgcacaccaagctggtggtgcgcgaggacgacctgtcgcttttt
ggctttgccgatgagagaagcctcgagctattcgaactgttgctctcggtctcgggggtg
gggcccaaagtggccctgaacctgctttcctctcagacccccgccctgctggcgcgggcc
ctggccgaaggcgacctgcgcctgctcacagcggcccagggggtgggtaagaagctggcc
gaacgcatcgcgctcgagctgcgcggcaaggtgccggcccacctgatgggcgaagggggc
cgcctggtgcacagcagccagaccgaggaggccgagttggccctcatcaccctgggtttc
cgcgagggccaggtgcgcagcatcgtggccgagatcgcccagaagaaccccggggccggc
acccaggagctcatcaagctggccctgaaagccctgcgctag

DBGET integrated database retrieval system