KEGG   Meiothermus ruber DSM 1279: Mrub_1855Help
Entry
Mrub_1855         CDS       T01193                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mrb00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mrb00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1911987..1912502
Genome map
AA seq 171 aa AA seqDB search
MARKIAFVVAMDQNRAIGRAGTLPWHLPDDLKRFRALTLGKTVLMGRKTFESIGRPLPKR
RNVVLTRDPAFAAEGVEVVHTLEDALKLDDELMVIGGGEIYTLFLPLVTHLHLTLVETVV
PDADAFFPPWNPTGWRETYREHHPADERHPWAFTYLDLERTRPQEASQGEG
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggcccggaagattgcttttgtggtggcgatggatcagaaccgcgccattggccgggct
gggacgctaccctggcacctgcccgacgacctcaagcggttccgcgcgctgaccctgggc
aagaccgtgctgatgggccgcaagacttttgagagcatcgggcggcccctccccaaacgc
cgcaacgtggtgctcacccgcgacccggcctttgccgccgagggcgtggaggtggtgcac
accctcgaggacgccctgaagctggacgacgagctgatggtgattggggggggtgagatt
tataccctgttcctgcccctggtcacccacctgcacctgaccctggtcgagacggtcgtc
cccgatgccgacgcctttttccccccgtggaacccgaccgggtggcgcgagacctaccgg
gagcaccaccccgccgacgaacgccacccctgggccttcacctacctcgacctggagcgc
acccgcccgcaagaggcatcccagggtgaagggtaa

DBGET integrated database retrieval system