KEGG   Meiothermus ruber DSM 1279: Mrub_1855Help
Entry
Mrub_1855         CDS       T01193                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mrub_1855
   00670 One carbon pool by folate
    Mrub_1855
Enzymes [BR:mrb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Mrub_1855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1911987..1912502
Genome map
AA seq 171 aa AA seqDB search
MARKIAFVVAMDQNRAIGRAGTLPWHLPDDLKRFRALTLGKTVLMGRKTFESIGRPLPKR
RNVVLTRDPAFAAEGVEVVHTLEDALKLDDELMVIGGGEIYTLFLPLVTHLHLTLVETVV
PDADAFFPPWNPTGWRETYREHHPADERHPWAFTYLDLERTRPQEASQGEG
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggcccggaagattgcttttgtggtggcgatggatcagaaccgcgccattggccgggct
gggacgctaccctggcacctgcccgacgacctcaagcggttccgcgcgctgaccctgggc
aagaccgtgctgatgggccgcaagacttttgagagcatcgggcggcccctccccaaacgc
cgcaacgtggtgctcacccgcgacccggcctttgccgccgagggcgtggaggtggtgcac
accctcgaggacgccctgaagctggacgacgagctgatggtgattggggggggtgagatt
tataccctgttcctgcccctggtcacccacctgcacctgaccctggtcgagacggtcgtc
cccgatgccgacgcctttttccccccgtggaacccgaccgggtggcgcgagacctaccgg
gagcaccaccccgccgacgaacgccacccctgggccttcacctacctcgacctggagcgc
acccgcccgcaagaggcatcccagggtgaagggtaa

DBGET integrated database retrieval system