KEGG   Meiothermus ruber DSM 1279: Mrub_2068Help
Entry
Mrub_2068         CDS       T01193                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mrub_2068
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Mrub_2068
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mrub_2068
Enzymes [BR:mrb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Mrub_2068
Exosome [BR:mrb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mrub_2068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2105024..2106535)
Genome map
AA seq 503 aa AA seqDB search
MKRRDLIKAGVVAGAAAALSAQAQSAQANQPGILTRARNLIFFAYDGMGWEDYAIAQFYA
RRVLGKPLALERFLATGVSGLQNTNSLTSFVTESSAASNAWSTGVKTVNGGLAIHVDGRQ
LTPIFALAKQQGKAVGLVSTATITHATPAGFVISNPDRNAEDQIAEQYLEFGAEVYLGGG
QRFFDPAVRRDKKDLYAAYAAKGYGVVKNLRELEASNASKLLGVFSSSHIPYEADRRFQG
VDTPSLAQMTRAALPRLAASSKGFVLQVEAARIDHANHLNDPAGSLWDILAADEALEVVM
NFVDQNPDTLLIIGSDHVCGAPALYGTGSSYRESSAGVLMLENQKGTFEFMLGRLGNNPS
PEQVVEIFRTVKGVTLKPEQAQAVVDAIAQRVYQPDTVRYGVQPANTLSWVMRQTDARKP
DLPNIGWNSGQHTASPTLFGVYGRGIGAARIGLIDNTYNFTLMTRALGIRFQNPVMSEQE
ALEVLRSRSERPWNHPEDALVLV
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcagagacctaatcaaagcaggagtggtcgccggagctgctgcggccctctcg
gcccaggcccagagcgcccaagccaaccagccgggcatcctgacccgtgcgcgcaacctg
attttcttcgcctacgacggcatgggctgggaagactacgccatcgcccagttctacgcc
cggcgggtgctgggcaagccgctggcattggagcgctttttggctactggtgtgagcggg
ctgcagaacaccaacagcctgaccagctttgtcaccgagtccagcgcagcctccaacgcc
tggagcaccggggtcaagaccgtgaacggcgggctggctattcacgtagatgggcgccag
ctcacccccatcttcgccctggccaagcagcagggcaaggccgtgggcctggtctccacc
gccaccatcacccatgccaccccggcgggcttcgtgatctccaaccccgaccgcaacgcc
gaagatcagatcgccgagcagtacctggagttcggcgcggaagtgtacctgggtggaggc
cagcgcttcttcgacccagcggtgcgccgcgataagaaagacctctacgccgcctacgcg
gccaaggggtatggggtggtgaagaacctgcgggagctcgaggcctccaacgcctccaag
ctgctgggcgtgttcagcagcagccacatcccctacgaggccgaccggcgcttccagggc
gtggacacccccagcctggcccagatgacccgcgcggccctgccccgtctggccgcttct
tccaagggctttgtgctccaggtcgaggccgcccgcatcgaccacgccaaccacctcaac
gaccccgcgggctcgctgtgggatatcctggccgccgacgaggccctggaagtggtgatg
aactttgtggatcagaaccccgacaccctgctgatcattggttccgaccatgtctgcggg
gcgcctgcgctgtatggcaccggctcttcctaccgcgagagcagcgccggggtgctgatg
ctcgagaaccagaaaggcaccttcgagttcatgctgggccgcctcggcaacaaccccagc
cccgaacaggtggtggaaatcttccgcaccgtgaagggcgtgaccctcaaacccgagcag
gcccaggcggtggtggacgccatcgcccagcgggtctaccagcccgacacggtgcgctac
ggcgtgcagcccgccaacaccctctcctgggtgatgcgccagaccgatgcccgcaagccc
gacctgcccaacatcggctggaactcggggcagcacaccgccagccccaccctgtttggg
gtgtatggccgggggattggggcggcccggatcggcctgattgacaacacctacaacttc
accctgatgacccgggccctgggcatccgcttccagaacccggtgatgagcgagcaggag
gccctcgaggtgctcaggagccgctccgagcgcccctggaaccatcccgaggacgccctg
gtgctggtctaa

DBGET integrated database retrieval system