KEGG   Meiothermus ruber DSM 1279: Mrub_2093Help
Entry
Mrub_2093         CDS       T01193                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mrub_2093
Enzymes [BR:mrb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Mrub_2093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2137197..2137868
Genome map
AA seq 223 aa AA seqDB search
MSRGNLFVMTGASGVGKGTIRGRLLEYHRMYYSISMTTRPPRPGERNGVDYYFVSKADFE
SKIAQNGFLEWAQYVDDYYGTPREPVEEALSKGQDVLLEIEVQGALQVKQTLPEAILVFI
IPPSLSELRRRLLVRGTDSLPKIRKRLERAVEEIRMADRFKYVLVNDQLDKAVSDFAAII
QAERLLQPRMHEAIERALSQDPALEKELDELERKRLEAGEAGS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtgggaatctgtttgtcatgactggggcttcgggggtgggcaaaggcaccata
cggggaaggctgctggagtaccaccgtatgtactattccatctccatgaccacccgccca
cccaggccaggcgagcgcaatggggtggactattactttgtgagcaaggccgattttgaa
agcaaaattgctcagaatggctttctggaatgggcccagtacgtagacgactactacgga
accccgcgcgagccggtagaagaagcgctcagcaaagggcaggacgtgctcctagaaatc
gaggtgcagggggctttgcaggtcaagcaaaccctgcccgaagccatcctggttttcatc
atcccgccctcgctctcggagctgcggcggcgtctgttggtacgcggcaccgacagcctg
cccaagattcgcaagcggctggagcgggccgtggaagaaatccgtatggccgaccgtttt
aaatatgtgctggtcaatgaccagctcgacaaggctgtctccgactttgcggccatcatc
caggccgagcggctgttgcagccccgcatgcacgaggccatcgagcgggcgctttcccaa
gatcccgccctggaaaaagagctagacgagctcgagcgcaaacggctcgaggcgggcgag
gccggttcataa

DBGET integrated database retrieval system