KEGG   Meiothermus ruber DSM 1279: Mrub_2118Help
Entry
Mrub_2118         CDS       T01193                                 

Definition
kynureninase
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Tryptophan metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mrb00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2167166..2168395
Genome map
AA seq 409 aa AA seqDB search
MTLAELQALDRTDPLAPKRAEFLLPEGVIYLDGNSLGALPKRVVARMEQVVQAEWGQSLI
KSWNLHGWIDLPQRVGARIARLIGAEPDEVIAADSTSVNLFKVLLAALELRPGRRVIVSD
IDNFPTDLYIAQGIAELRGGYELRFVKKDQLEEALDEQTAVLMLTEVDYRTGYLYDMARL
TRLAQQKGALTIWDLAHSAGALPVQLNRHGVDFAVGCGYKYLNGGPGAPAFLFVARRHQE
ATRPFLTGWMGHQAPFAFVPEYLPALDIRRLTVGTPGVLSMSALEAALEVFEGVEMEQVR
QKSLQLTDLFIELMEPLAARYGFQLATPREHHRRGSQVAYRHPEGYAIMQALISQGVVGD
FRAPDILRFGFTPLYLRYEDVYHAVQRLEQVMQSGLWQEARFQERAKVT
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaccttagccgagctgcaagccctcgaccgcaccgaccccctggcccccaagcgggct
gagttcctgctgcccgaaggggtcatctacctcgacggcaactcgctgggggccctgccc
aagcgggtggtggcccgcatggaacaggtggtacaggccgagtggggccagagcctgatc
aagagctggaacctgcacggctggattgacctgccccagcgggtgggggccaggatcgcc
cggctgattggggccgagcccgacgaggtcatcgccgccgactcgacctcggtcaacctg
ttcaaggtgctgctggccgccctcgagctgcgcccggggcgcagggttatcgtttcggac
atcgacaacttccccaccgacctctacatcgcccagggcatcgccgagcttcggggcggg
tacgagctgcgcttcgtaaaaaaagaccagctcgaggaggccctcgacgagcagaccgcg
gtgctgatgctgaccgaggtggactaccgcaccggctacctctacgacatggcccggctc
acccggctggcccagcagaaaggggccctgaccatctgggatctggcccatagcgcgggg
gcccttccggtgcagctcaaccggcacggggtggattttgccgtgggttgcggctacaag
tacctcaacggcggcccgggcgcgccggcttttctgttcgtggcccggcgacaccaggag
gccacccggcctttcctgaccggctggatggggcaccaggctcccttcgcttttgtaccc
gagtacctgcccgccctggatatccggcgcctgacggtggggacgcccggcgtgctctcg
atgagcgcgttggaagcggcgctcgaggtcttcgagggcgtggagatggagcaggtgcgg
caaaagtcgctacagctcaccgacctcttcatcgagctgatggagccgctggccgcccgt
tatggcttccagctcgccacaccgcgtgaacaccaccgccggggcagccaggtggcctac
cggcaccccgagggctacgcgattatgcaggccctgatcagccagggggtggtcggcgac
ttccgcgcccccgacatcctacgctttggcttcaccccgctgtacctgcgctatgaggac
gtctaccacgcagtacagcggctggaacaggttatgcaaagcgggctctggcaagaagcg
cgcttccaggaaagggccaaggtgacctga

DBGET integrated database retrieval system