KEGG   Meiothermus ruber DSM 1279: Mrub_2222Help
Entry
Mrub_2222         CDS       T01193                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mrub_2222
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mrub_2222
   00620 Pyruvate metabolism
    Mrub_2222
   00640 Propanoate metabolism
    Mrub_2222
  Energy metabolism
   00680 Methane metabolism
    Mrub_2222
Enzymes [BR:mrb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mrub_2222
Lipid biosynthesis proteins [BR:mrb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mrub_2222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2273099..2275024
Genome map
AA seq 641 aa AA seqDB search
MSNPIWFPSDAYTRGSHIEALLKHLGLDSYEALYRFSIEQSEAFWEATLQLLGLEWLTPY
RQVLDTSQGPQWPRWFVGGQLNLAYNALHHARTRKDAPALIWEGEEGAVARLSYGELEAA
VAQAAHALEALGIQKGDRVGLFLPMLPETAISALAVAQIGAIFVPIFSGYAPEAAATRLQ
DAGARLVITADGFYRRGSRVDLLNNARRAAALSPSVEKLLVVRRFGDVPLAANEVAWDKH
VLGQPSSAAYQPMDSMDPFMLIYTSGTTGKPKGTVHYHAGFPIKAAQDMAHLFDLRQHET
LFWFTDMGWMMGPWAILGALTIGGTVLLYEGAPDYPDPGRLWALCERHRVTHLGLSPTLV
RALMPLGDDWVRQHDLSSLRMLGSTGEPWNLEPYLWFFKTVGQGRVPIINYSGGTEVGGG
ILGCTAWRPIKPMGFNTAVPGMHAEVLDGMGKPVRDEVGELAVLAPWPGQTKGFWKAPER
YLETYWQRFENVWVHGDWAILDREGHWMIQGRSDDTLKIAGKRVGPAEYESAAVEHPSVK
EAAAIGIPHPVKGEAAVLFVVLRSGHTPSPDLEQAISETITQRLGKALKPERILFVPDLP
KTRNAKVMRRVIRAAFLGQHPGDLSALENPQAVEAIQQAAR
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccccatctggtttccctccgatgcgtacacccgcggcagccacatagaagcc
ctgctaaagcacctgggcctggatagctatgaagccctttaccgcttcagcatcgagcag
tccgaggctttttgggaggccaccctgcagcttttgggccttgagtggttgaccccttac
cggcaggtgctggacacctcccagggcccgcagtggccccggtggtttgtgggcgggcag
ctcaatctggcttacaacgccctgcatcatgccagaacccgcaaagacgccccggccctg
atctgggaaggggaagagggggccgtagcgcgcttgagctacggggagctcgaggccgcc
gtggcccaggccgcccacgcgctcgaggccctgggcatccagaaaggcgaccgggtaggc
ctgtttctgcccatgctgcccgaaaccgccatcagcgccctggccgtggcacaaattggg
gccatctttgtacccatcttctccggttacgcccccgaagcagcggccacccggctgcag
gatgccggggccaggctggtcatcaccgcggatggcttctaccggaggggcagccgggtt
gatcttctgaacaacgcccgccgcgccgcagccctttcgccaagcgtagagaagctgctg
gtggtgcgccgctttggggacgtgcccctggccgccaacgaagtggcctgggacaagcac
gtcctcggccagccctcgagcgcagcataccaacccatggacagcatggatccgttcatg
ctgatctacacctccggcaccaccggcaaacccaagggcaccgtgcactaccatgctggc
tttcccattaaagccgcccaggacatggcccacctcttcgatctgcgtcagcacgaaacc
ctgttctggttcaccgacatgggctggatgatggggccgtgggccattctaggcgctctt
accatcggcggtacggtgctgctgtacgaaggggcccccgattacccggatccaggccgc
ttgtgggccctttgcgagcgacacagggtaacccacctgggcctctcccccaccctggtg
cgggccctgatgcccctgggggatgactgggtacgccagcacgacctgtccagcttgcgc
atgctgggctctaccggcgagccctggaacctcgagccctacctctggttcttcaagact
gtgggccagggccgggttcccatcatcaactactccgggggcaccgaggttggtggcggc
atcctggggtgcacagcctggcgacccattaagcccatgggcttcaacaccgcggtaccc
ggcatgcacgccgaagtgctcgatggcatgggcaagcccgtgcgggacgaggtgggcgag
ttagcggtgctggccccctggccgggccagaccaagggcttctggaaagcgcctgagcgt
tacctcgaaacctactggcaacgctttgaaaacgtctgggtgcacggcgactgggccatt
ttggatcgagaggggcactggatgattcagggccggagcgacgacaccctcaaaatcgcc
ggtaagcgggtggggcccgccgagtacgaaagcgccgccgtggagcaccccagcgtaaaa
gaagccgccgccatcggcataccgcacccggtaaagggcgaggccgcggtgctattcgtg
gtgctgcgcagcggccatacccccagccccgacctcgagcaggccatcagcgaaaccatc
acccagcgcctgggcaaggccctcaaacccgaacgcatactgtttgtgcccgatctaccc
aaaacccgcaacgccaaggtgatgcgccgggtgatacgggccgcctttctgggccagcac
cccggcgatctctcggcgctggagaacccccaggcggtagaagccatccagcaagctgcc
cgatag

DBGET integrated database retrieval system