KEGG   Meiothermus ruber DSM 1279: Mrub_2222Help
Entry
Mrub_2222         CDS       T01193                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00010  Glycolysis / Gluconeogenesis
mrb00620  Pyruvate metabolism
mrb00640  Propanoate metabolism
mrb00680  Methane metabolism
mrb01100  Metabolic pathways
mrb01110  Biosynthesis of secondary metabolites
mrb01120  Microbial metabolism in diverse environments
mrb01130  Biosynthesis of antibiotics
mrb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mrub_2222
   00620 Pyruvate metabolism
    Mrub_2222
   00640 Propanoate metabolism
    Mrub_2222
  Energy metabolism
   00680 Methane metabolism
    Mrub_2222
Enzymes [BR:mrb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mrub_2222
Lipid biosynthesis proteins [BR:mrb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mrub_2222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADD28975
UniProt: D3PKV1
Position
2273099..2275024
Genome map
AA seq 641 aa AA seqDB search
MSNPIWFPSDAYTRGSHIEALLKHLGLDSYEALYRFSIEQSEAFWEATLQLLGLEWLTPY
RQVLDTSQGPQWPRWFVGGQLNLAYNALHHARTRKDAPALIWEGEEGAVARLSYGELEAA
VAQAAHALEALGIQKGDRVGLFLPMLPETAISALAVAQIGAIFVPIFSGYAPEAAATRLQ
DAGARLVITADGFYRRGSRVDLLNNARRAAALSPSVEKLLVVRRFGDVPLAANEVAWDKH
VLGQPSSAAYQPMDSMDPFMLIYTSGTTGKPKGTVHYHAGFPIKAAQDMAHLFDLRQHET
LFWFTDMGWMMGPWAILGALTIGGTVLLYEGAPDYPDPGRLWALCERHRVTHLGLSPTLV
RALMPLGDDWVRQHDLSSLRMLGSTGEPWNLEPYLWFFKTVGQGRVPIINYSGGTEVGGG
ILGCTAWRPIKPMGFNTAVPGMHAEVLDGMGKPVRDEVGELAVLAPWPGQTKGFWKAPER
YLETYWQRFENVWVHGDWAILDREGHWMIQGRSDDTLKIAGKRVGPAEYESAAVEHPSVK
EAAAIGIPHPVKGEAAVLFVVLRSGHTPSPDLEQAISETITQRLGKALKPERILFVPDLP
KTRNAKVMRRVIRAAFLGQHPGDLSALENPQAVEAIQQAAR
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccccatctggtttccctccgatgcgtacacccgcggcagccacatagaagcc
ctgctaaagcacctgggcctggatagctatgaagccctttaccgcttcagcatcgagcag
tccgaggctttttgggaggccaccctgcagcttttgggccttgagtggttgaccccttac
cggcaggtgctggacacctcccagggcccgcagtggccccggtggtttgtgggcgggcag
ctcaatctggcttacaacgccctgcatcatgccagaacccgcaaagacgccccggccctg
atctgggaaggggaagagggggccgtagcgcgcttgagctacggggagctcgaggccgcc
gtggcccaggccgcccacgcgctcgaggccctgggcatccagaaaggcgaccgggtaggc
ctgtttctgcccatgctgcccgaaaccgccatcagcgccctggccgtggcacaaattggg
gccatctttgtacccatcttctccggttacgcccccgaagcagcggccacccggctgcag
gatgccggggccaggctggtcatcaccgcggatggcttctaccggaggggcagccgggtt
gatcttctgaacaacgcccgccgcgccgcagccctttcgccaagcgtagagaagctgctg
gtggtgcgccgctttggggacgtgcccctggccgccaacgaagtggcctgggacaagcac
gtcctcggccagccctcgagcgcagcataccaacccatggacagcatggatccgttcatg
ctgatctacacctccggcaccaccggcaaacccaagggcaccgtgcactaccatgctggc
tttcccattaaagccgcccaggacatggcccacctcttcgatctgcgtcagcacgaaacc
ctgttctggttcaccgacatgggctggatgatggggccgtgggccattctaggcgctctt
accatcggcggtacggtgctgctgtacgaaggggcccccgattacccggatccaggccgc
ttgtgggccctttgcgagcgacacagggtaacccacctgggcctctcccccaccctggtg
cgggccctgatgcccctgggggatgactgggtacgccagcacgacctgtccagcttgcgc
atgctgggctctaccggcgagccctggaacctcgagccctacctctggttcttcaagact
gtgggccagggccgggttcccatcatcaactactccgggggcaccgaggttggtggcggc
atcctggggtgcacagcctggcgacccattaagcccatgggcttcaacaccgcggtaccc
ggcatgcacgccgaagtgctcgatggcatgggcaagcccgtgcgggacgaggtgggcgag
ttagcggtgctggccccctggccgggccagaccaagggcttctggaaagcgcctgagcgt
tacctcgaaacctactggcaacgctttgaaaacgtctgggtgcacggcgactgggccatt
ttggatcgagaggggcactggatgattcagggccggagcgacgacaccctcaaaatcgcc
ggtaagcgggtggggcccgccgagtacgaaagcgccgccgtggagcaccccagcgtaaaa
gaagccgccgccatcggcataccgcacccggtaaagggcgaggccgcggtgctattcgtg
gtgctgcgcagcggccatacccccagccccgacctcgagcaggccatcagcgaaaccatc
acccagcgcctgggcaaggccctcaaacccgaacgcatactgtttgtgcccgatctaccc
aaaacccgcaacgccaaggtgatgcgccgggtgatacgggccgcctttctgggccagcac
cccggcgatctctcggcgctggagaacccccaggcggtagaagccatccagcaagctgcc
cgatag

DBGET integrated database retrieval system