KEGG   Meiothermus ruber DSM 1279: Mrub_2402Help
Entry
Mrub_2402         CDS       T01193                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mrub_2402
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mrub_2402
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mrub_2402
Enzymes [BR:mrb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mrub_2402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2455639..2456937
Genome map
AA seq 432 aa AA seqDB search
MVRYHSTRDPHKKLVTFEEALLKGLAPDGGLYIPDRIPHIAPEAWLGARSLAEVGVAVLG
EWLKGDIPVSDLEAIVHDALNFPCPLVKLSDDLYVLELFHGPTLSFKDFGARTMARLMQY
FLRKRGERRIILVATSGDTGSAVADGFAGQENIEVVLLYPKGKVSEVQERQLITQRPGVR
SFAVEGTFDDCQRMVKEAFVDPELAHLPLSSANSINIGRLLPQALYYLWAVAQLHRHTQI
TEVNFCVPSGNLGNLMAGLLAALMGQPVHRFIAAHNDNHFFPDFLQGKAEAYQFHPTIAT
LSNAMDVGAPSNFERLYTLLGAEKLRAWIWGTTVTNEATLERMQKTHETYSYVACPHTAV
GLEAQARYRQQTADPTPIISLACAHPAKFPDVVLKALGQEPPREPALQALYSRPTQVQAI
GPTLQALKTFLL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggttcgctaccacagcacccgcgatccccataaaaaactggtaactttcgaggaagcc
ttgctcaaagggctggcccccgatggggggctgtacatccccgaccgcattccccacatt
gcaccggaggcctggttgggcgcccgctcccttgccgaggtgggcgtggcggttctggga
gaatggctcaagggggatattcctgtctccgacctggaagccatcgtccacgatgccctg
aacttcccctgtccgctggtaaagctatcggacgacctgtacgtcctcgagctcttccac
ggccccaccctttccttcaaagattttggggcccgcaccatggcccgcctgatgcagtat
tttctgcgcaagcgcggtgagcgccgcatcatcctggtagccacctcgggcgacaccggc
agcgccgtggccgatggctttgccgggcaggaaaacatcgaggtggtcttgctctaccct
aaaggcaaggtaagcgaggtgcaggagcgccagctcatcacccagcgcccgggcgtacgc
agcttcgcggtggagggcaccttcgacgactgccagcgcatggtcaaggaggccttcgta
gaccccgaactggcccacctacccctgagcagcgctaactccatcaacattgggcgcctg
ctcccccaggccctctactacctgtgggccgtcgcacagcttcaccgccacacccagatc
acagaggtgaatttctgcgtccccagcggcaacctgggcaacctgatggccggcctcctg
gccgcgctgatggggcagcctgtccaccgcttcatcgctgcccataacgacaaccacttc
ttccccgactttctgcaaggcaaggccgaagcctaccagttccaccccaccatcgccacc
ctctctaatgccatggacgtgggcgcccccagcaactttgagcgcctgtacaccctgcta
ggggcagaaaagctgcgggcctggatctggggtactacggtgacgaatgaggccaccctc
gagcgcatgcaaaaaacccacgagacctacagctacgtggcctgtccgcacactgccgtc
ggcctggaggcccaggcccgctaccgccagcagactgccgaccccacccccattatcagc
ctggcctgcgcccatccagccaagtttcccgatgtggtgctgaaagccctgggccaggaa
cccccccgcgagccagcgctgcaagcgctctacagccgccccacccaggtgcaggccatc
ggcccaaccctacaggccctcaaaaccttcctgctttag

DBGET integrated database retrieval system