KEGG   Meiothermus ruber DSM 1279: Mrub_2402Help
Entry
Mrub_2402         CDS       T01193                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mrub_2402
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mrub_2402
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mrub_2402
Enzymes [BR:mrb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mrub_2402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2455639..2456937
Genome map
AA seq 432 aa AA seqDB search
MVRYHSTRDPHKKLVTFEEALLKGLAPDGGLYIPDRIPHIAPEAWLGARSLAEVGVAVLG
EWLKGDIPVSDLEAIVHDALNFPCPLVKLSDDLYVLELFHGPTLSFKDFGARTMARLMQY
FLRKRGERRIILVATSGDTGSAVADGFAGQENIEVVLLYPKGKVSEVQERQLITQRPGVR
SFAVEGTFDDCQRMVKEAFVDPELAHLPLSSANSINIGRLLPQALYYLWAVAQLHRHTQI
TEVNFCVPSGNLGNLMAGLLAALMGQPVHRFIAAHNDNHFFPDFLQGKAEAYQFHPTIAT
LSNAMDVGAPSNFERLYTLLGAEKLRAWIWGTTVTNEATLERMQKTHETYSYVACPHTAV
GLEAQARYRQQTADPTPIISLACAHPAKFPDVVLKALGQEPPREPALQALYSRPTQVQAI
GPTLQALKTFLL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggttcgctaccacagcacccgcgatccccataaaaaactggtaactttcgaggaagcc
ttgctcaaagggctggcccccgatggggggctgtacatccccgaccgcattccccacatt
gcaccggaggcctggttgggcgcccgctcccttgccgaggtgggcgtggcggttctggga
gaatggctcaagggggatattcctgtctccgacctggaagccatcgtccacgatgccctg
aacttcccctgtccgctggtaaagctatcggacgacctgtacgtcctcgagctcttccac
ggccccaccctttccttcaaagattttggggcccgcaccatggcccgcctgatgcagtat
tttctgcgcaagcgcggtgagcgccgcatcatcctggtagccacctcgggcgacaccggc
agcgccgtggccgatggctttgccgggcaggaaaacatcgaggtggtcttgctctaccct
aaaggcaaggtaagcgaggtgcaggagcgccagctcatcacccagcgcccgggcgtacgc
agcttcgcggtggagggcaccttcgacgactgccagcgcatggtcaaggaggccttcgta
gaccccgaactggcccacctacccctgagcagcgctaactccatcaacattgggcgcctg
ctcccccaggccctctactacctgtgggccgtcgcacagcttcaccgccacacccagatc
acagaggtgaatttctgcgtccccagcggcaacctgggcaacctgatggccggcctcctg
gccgcgctgatggggcagcctgtccaccgcttcatcgctgcccataacgacaaccacttc
ttccccgactttctgcaaggcaaggccgaagcctaccagttccaccccaccatcgccacc
ctctctaatgccatggacgtgggcgcccccagcaactttgagcgcctgtacaccctgcta
ggggcagaaaagctgcgggcctggatctggggtactacggtgacgaatgaggccaccctc
gagcgcatgcaaaaaacccacgagacctacagctacgtggcctgtccgcacactgccgtc
ggcctggaggcccaggcccgctaccgccagcagactgccgaccccacccccattatcagc
ctggcctgcgcccatccagccaagtttcccgatgtggtgctgaaagccctgggccaggaa
cccccccgcgagccagcgctgcaagcgctctacagccgccccacccaggtgcaggccatc
ggcccaaccctacaggccctcaaaaccttcctgctttag

DBGET integrated database retrieval system