KEGG   Meiothermus ruber DSM 1279: Mrub_2429Help
Entry
Mrub_2429         CDS       T01193                                 

Definition
magnesium protoporphyrin chelatase putative
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mrub_2429
Enzymes [BR:mrb01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mrub_2429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2481025..2482446
Genome map
AA seq 473 aa AA seqDB search
MTKARTLGELKRTYPLEKLRRSVKDEARENLIAKLRAGERLFPGIQSYDDSVIPSLVNAI
LARHNFILLGLRGQAKSRILRQLTELLDDEVPALPTEIRDNPLFPLSAEAKRLLEEAGDD
APIVWIPRSERYVEKLATPDTTVADILGDIDPIKAAKRGTGLADLEAVHYGLLPRANRGI
FGINEVADLAPKVQVALFNILQEGDVQIRGYPVRLELDVWIAFTANPQDYTARGKIVTPL
KDRIGSEIRTHYPRTLEEGLSITRQEAWVARAEGMYIPAYVAEASEAVAFVAREDKRVDK
TSGVSQRLSISLLELVASNAERRALLAGERPVARPLDLYAALPAITGKIELEYEGELQGA
ERVAKDLLQKAFGLAYGERARGLQVDEIVQYFADGNLLTLPEGSAKAVLKEMEKVPGLIA
AARKLEPQTTPEALVAAGEFILEGLAGRRKIARGEESYSAPLERERERWGSGN
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggcccgaaccctcggcgaactcaagcgcacctaccccctagagaaattgcgt
cgcagcgtaaaggacgaagcgcgggagaacctgatcgccaaactccgcgcgggtgagcgg
cttttccccggtattcagagctacgacgactcggtgattcccagcctggtcaatgccatc
ctggcccggcacaacttcattctgctgggcttgcgcgggcaggccaaaagccgcatcttg
cgccagctcaccgaacttttggacgatgaagtgccggccctgcccaccgagatccgcgac
aaccccctctttcccctctcggccgaggccaagcgcctgctggaggaggccggcgacgac
gctcccatcgtctggattcctcgctcggagcgctacgtggaaaagctggccacccccgac
accaccgtggccgatattctgggcgacattgaccccatcaaggccgccaagcgcggcacc
gggctggccgacctcgaggccgtccactacggcctcttgccccgcgccaaccggggcatc
ttcggcatcaacgaggtggccgacctggcccccaaggtgcaggtggcgcttttcaatatc
ctgcaagaaggcgacgtgcagatccggggctatccggtgcgccttgagctcgacgtctgg
attgccttcaccgccaacccccaggactacaccgcccgcggcaagatcgtcacgcccctc
aaagaccgcatcggctcggagatccgcacccactacccccgcaccctcgaggagggcctt
tccatcacccgccaggaggcctgggtcgctcgtgcggaaggaatgtacattcccgcctac
gtggccgaggcttcggaggcggtggcctttgtggcccgcgaggacaagcgggtggacaag
acctcgggggtctcgcagcgcctctccattagcttgctggaactggtggcctccaatgcc
gagcggcgggccctgctggcgggggagcgcccggtggcccggcccctcgacctctacgcg
gcgctaccggccattaccggcaaaatcgagctggagtacgagggtgagctgcagggcgcc
gagcgggtggctaaagacctcttgcaaaaagcctttggcctggcctacggcgaacgggcc
cggggcctgcaggtagacgagatcgtgcagtacttcgccgatggcaacctcctcaccctg
cccgagggcagcgccaaagcggtgcttaaggagatggaaaaggtgccggggctgatcgcg
gctgcccggaagctcgagccccagaccacccccgaggccctggtggccgccggggagttc
atcctcgagggtctggcgggccgccgcaagatcgcccgcggcgaggagagctacagcgcc
cccctcgagcgggaacgcgaacgctggggcagcggcaactga

DBGET integrated database retrieval system