KEGG   Meiothermus ruber DSM 1279: Mrub_2503Help
Entry
Mrub_2503         CDS       T01193                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mrb00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mrb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2552221..2553666)
Genome map
AA seq 481 aa AA seqDB search
MPTLQELFGLFGQTAPALEVRGVTHDSRLVQPGFVFVAIPGVPLPSRKPFDGHDYIPQAI
QNGAVAVVGMRELHLSVPYLRVADARAALADLSAAFWGYPAQRLELLGVTGSKGKTTVAV
LLHHLLQRARPPVGRLSTVGIKIGEEELFLPGHFTTPEAPQVQEMLHRFVQAGCRQAVLE
VSSHALALERVRGLEYRVGVFTNLYQDHLDLHGSMENYFAEKKKLLERSRFAVVNSDNPW
TQTLRGRPQTWSYGQQGDWQAHNLVESSTGLEFEVVSPMGRFAVRLPMVGRFNAENALAA
MAAAAQVGLSVEQIQEGLAGFPGVPGRMQLVQAAPFRVVVDFAHTGASLEAALQTLRPTT
QGRLLVVIGAAGNQDPSRRVGIGQVAARLADLAIFTEEDHRTEPLEAILEAMAQAHGDPR
RYVLIPDRREAIRYAIQEAQPGDTLLFSGKGHERTLERGTEAIPWNEVDEVRRALAAQPV
D
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccctgcaagagctttttggactattcggccagaccgccccggccctggaggtg
cggggtgtgacccacgactcgcgcctggtgcagccgggttttgtcttcgtggcgatcccc
ggcgtgcccctgccgagccgcaagcctttcgatgggcacgactacatcccccaggccatc
cagaacggggcggtggcggtggtggggatgcgcgagctgcacctgagcgtgccctacctg
cgggtggcggatgcgcgcgcggccctggccgatctatcggcggccttctgggggtatccg
gcgcaacggctggagctgctgggggtgaccggctccaagggcaaaaccaccgttgcggtg
ctgctccatcacctgctgcaaagggcccgtccaccggtgggcaggctctccacggtgggc
atcaaaattggcgaagaagagctttttttgcccggccacttcaccacccccgaggccccg
caggtacaggagatgctgcaccgcttcgtgcaggcgggctgccggcaggcggtgctcgag
gtcagcagccacgcgctggcgctggagcgggtgcgggggctggagtatcgggtgggggtg
ttcaccaacctctaccaagaccacctcgacctgcacgggagcatggagaactactttgcc
gagaaaaagaagctcctggagcgctcgaggttcgccgttgtgaacagcgacaacccctgg
acccagaccctgcggggccgcccccagacctggagctacggccagcaaggggactggcag
gcccacaacctggtggaaagcagtacgggcctcgagtttgaggtggtctcgcccatgggc
cggtttgccgtacggcttcccatggtgggccgcttcaatgccgagaacgccctggccgcc
atggccgctgctgcgcaggtgggcctctcggtggagcaaatccaggaaggcctggctggt
tttcccggcgtgccgggccggatgcagctcgtgcaggccgcgccctttcgggtggtggtg
gacttcgcccacaccggggccagcctcgaggccgccctgcagaccctgcgccccaccacc
cagggccgcctgctggtggtgatcggggccgccgggaatcaggatcccagccggcgcgtg
ggcatcggccaggtggcggcgcggctggccgatctcgccatctttaccgaggaagaccac
cgcaccgagccgttggaggccattttggaggccatggcccaggcccacggcgacccccgc
cgctacgtgctcatccccgaccggcgcgaggccatccgctacgccatccaggaagcccag
ccgggcgataccctgctctttagcggcaaaggccacgagcggacgctcgagcggggcacc
gaggccattccctggaacgaggtggacgaggtgcgcagggccctggcggcgcaaccggta
gactga

DBGET integrated database retrieval system