KEGG   Meiothermus ruber DSM 1279: Mrub_2526Help
Entry
Mrub_2526         CDS       T01193                                 

Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mrub_2526
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mrub_2526
   00630 Glyoxylate and dicarboxylate metabolism
    Mrub_2526
Enzymes [BR:mrb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mrub_2526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2572138..2573712)
Genome map
AA seq 524 aa AA seqDB search
MSEMPKGVQIIGPKLPASDTVLTPEALAFLAGLQREFNAVRKGLLQRRAEVAQRIQAGEK
PAFLEHTRFIREGDWKVAPAPPDLNDRRVEITGPTERKMMINALNSGAKVFMADCEDALS
PTWENVVQGQQNLMDAVRRTIHLSTPEKEYRLNEKIATLVVRPRGWHLNERHVLVDGEPM
SGSLFDFGLYFFHNAHELLKRGSGPYFYLPKLENHLEARLWNDVFKFAQSYMGIPQGTIR
ATVLIETILAAFEMEEILYELREHAAGLNAGRWDYIFSCIKKFATHEVLFPDRAQVTMTV
PFMRAYTELLVRTCHKRGAHAIGGMSAFIPSRKDPEVNAKAIEQVTKDKERESGDGFDGT
WVAHPDLVPVAMAVFDKVLGDKPNQKDRLREDVDGKIKAEDLINFEVPGGKITEAGIRNN
ISVELQYMAAWLGGSGAVAIFNLMEDAATAEISRSQLWQWLRKGARLDDGRTFTRELYAQ
LKQEEMAKLAGLRNLEEAAQLLDELVLQPEFKEFLTLPAYERLA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatgcccaaaggcgtgcaaattataggccccaaactccccgcttccgatacg
gtgctgacccctgaggccctggcttttctggctgggcttcagcgcgagttcaacgcggtg
cgcaagggtttgttgcagcgccgcgccgaggtggcccagcgcattcaggctggtgagaag
ccggctttcctcgagcacacccggtttattcgggaaggggactggaaggtggcccccgcc
ccccccgacctcaacgaccgccgggtcgagattaccggccccaccgaacgcaaaatgatg
atcaatgccctcaactccggggccaaggttttcatggctgactgcgaggacgcgctctca
cccacctgggaaaacgtggtgcagggtcagcaaaacctgatggatgcggtacgccgtacc
attcacctgagcacccccgagaaggagtaccggctgaacgagaaaattgccacgttggtg
gtgcgccctaggggctggcatctgaatgagcggcacgtgttggtggatggcgaacccatg
tccggaagcctcttcgacttcgggctttattttttccacaacgcccacgagctactaaag
cgcggtagcggcccctacttctacctgcccaagctggagaaccacctcgaggcccgcctc
tggaacgacgtcttcaagtttgcccagagctatatgggcattccccagggcaccatccgg
gccacggtgctcatcgagaccatcctggccgctttcgagatggaggaaatcctctacgaa
ttgcgcgaacacgccgccggcctcaacgccgggcgctgggactacatctttagctgcatc
aaaaagttcgccacccacgaggtgctcttccccgaccgggcccaggtcaccatgactgta
cccttcatgcgggcctacaccgagctgctggtgcgcacctgccacaagcgtggggcccac
gccattggggggatgtcggccttcatccccagccgcaaagaccccgaggtgaacgccaag
gccatcgagcaggttaccaaagataaggagcgggaatcgggcgacggcttcgacggcacc
tgggtggcccaccccgacctggtgccggtggccatggcggtcttcgataaggtgctgggt
gataaacccaaccagaaagaccgcctgcgcgaggatgtggacggcaagattaaggccgaa
gatctgattaacttcgaggtgccgggtggcaagattaccgaggcggggattcgcaacaac
atcagcgtggagctgcagtacatggcggcctggctgggtggaagcggggcggtggctatt
ttcaacctgatggaggacgccgccaccgccgagatttcccgctcgcaactgtggcagtgg
ctgcgtaaaggggcccggctggacgatggccgcacctttactagggagctatacgcccag
ctcaagcaagaagaaatggccaagctggccggcctgaggaacctggaagaggccgcccag
ctcctggacgagctggtgttgcagccggagttcaaggagttcctgaccctgccggcctac
gagcggctggcctaa

DBGET integrated database retrieval system