KEGG   Meiothermus ruber DSM 1279: Mrub_2526Help
Entry
Mrub_2526         CDS       T01193                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mrub_2526
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mrub_2526
   00630 Glyoxylate and dicarboxylate metabolism
    Mrub_2526
Enzymes [BR:mrb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mrub_2526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2572138..2573712)
Genome map
AA seq 524 aa AA seqDB search
MSEMPKGVQIIGPKLPASDTVLTPEALAFLAGLQREFNAVRKGLLQRRAEVAQRIQAGEK
PAFLEHTRFIREGDWKVAPAPPDLNDRRVEITGPTERKMMINALNSGAKVFMADCEDALS
PTWENVVQGQQNLMDAVRRTIHLSTPEKEYRLNEKIATLVVRPRGWHLNERHVLVDGEPM
SGSLFDFGLYFFHNAHELLKRGSGPYFYLPKLENHLEARLWNDVFKFAQSYMGIPQGTIR
ATVLIETILAAFEMEEILYELREHAAGLNAGRWDYIFSCIKKFATHEVLFPDRAQVTMTV
PFMRAYTELLVRTCHKRGAHAIGGMSAFIPSRKDPEVNAKAIEQVTKDKERESGDGFDGT
WVAHPDLVPVAMAVFDKVLGDKPNQKDRLREDVDGKIKAEDLINFEVPGGKITEAGIRNN
ISVELQYMAAWLGGSGAVAIFNLMEDAATAEISRSQLWQWLRKGARLDDGRTFTRELYAQ
LKQEEMAKLAGLRNLEEAAQLLDELVLQPEFKEFLTLPAYERLA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatgcccaaaggcgtgcaaattataggccccaaactccccgcttccgatacg
gtgctgacccctgaggccctggcttttctggctgggcttcagcgcgagttcaacgcggtg
cgcaagggtttgttgcagcgccgcgccgaggtggcccagcgcattcaggctggtgagaag
ccggctttcctcgagcacacccggtttattcgggaaggggactggaaggtggcccccgcc
ccccccgacctcaacgaccgccgggtcgagattaccggccccaccgaacgcaaaatgatg
atcaatgccctcaactccggggccaaggttttcatggctgactgcgaggacgcgctctca
cccacctgggaaaacgtggtgcagggtcagcaaaacctgatggatgcggtacgccgtacc
attcacctgagcacccccgagaaggagtaccggctgaacgagaaaattgccacgttggtg
gtgcgccctaggggctggcatctgaatgagcggcacgtgttggtggatggcgaacccatg
tccggaagcctcttcgacttcgggctttattttttccacaacgcccacgagctactaaag
cgcggtagcggcccctacttctacctgcccaagctggagaaccacctcgaggcccgcctc
tggaacgacgtcttcaagtttgcccagagctatatgggcattccccagggcaccatccgg
gccacggtgctcatcgagaccatcctggccgctttcgagatggaggaaatcctctacgaa
ttgcgcgaacacgccgccggcctcaacgccgggcgctgggactacatctttagctgcatc
aaaaagttcgccacccacgaggtgctcttccccgaccgggcccaggtcaccatgactgta
cccttcatgcgggcctacaccgagctgctggtgcgcacctgccacaagcgtggggcccac
gccattggggggatgtcggccttcatccccagccgcaaagaccccgaggtgaacgccaag
gccatcgagcaggttaccaaagataaggagcgggaatcgggcgacggcttcgacggcacc
tgggtggcccaccccgacctggtgccggtggccatggcggtcttcgataaggtgctgggt
gataaacccaaccagaaagaccgcctgcgcgaggatgtggacggcaagattaaggccgaa
gatctgattaacttcgaggtgccgggtggcaagattaccgaggcggggattcgcaacaac
atcagcgtggagctgcagtacatggcggcctggctgggtggaagcggggcggtggctatt
ttcaacctgatggaggacgccgccaccgccgagatttcccgctcgcaactgtggcagtgg
ctgcgtaaaggggcccggctggacgatggccgcacctttactagggagctatacgcccag
ctcaagcaagaagaaatggccaagctggccggcctgaggaacctggaagaggccgcccag
ctcctggacgagctggtgttgcagccggagttcaaggagttcctgaccctgccggcctac
gagcggctggcctaa

DBGET integrated database retrieval system