KEGG   Meiothermus ruber DSM 1279: Mrub_2621Help
Entry
Mrub_2621         CDS       T01193                                 

Definition
translation elongation factor Tu
Orthology
K02358  
elongation factor Tu
Organism
mrb  Meiothermus ruber DSM 1279
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2656550..2657767)
Genome map
AA seq 405 aa AA seqDB search
MAKGVFERTKPHVNVGTIGHVDHGKTTLTAAITFVAAAANPNVEVQAYDQIDKAPEEKAR
GITINTAHVEYETEKRHYSHVDCPGHADYVKNMITGAAQMDGAILVVSGTDGPMPQTREH
ILLSRQVGVPYIIVFLNKIDMVDDPELLDLVEMEIRDLLNQYEFPGDDTPIIRGSGLKAL
EHMMAHPKTQRGENEWVDKIWELLDAIDSYIPTPQRDVDKPFLMPVEDVFTITGRGTVAT
GRIERGKIKTGDEVEIVGLRETQKTVVTGVEMHRKTLSEGIAGDNVGLLLRGVSREDVER
GQVLAKPGSVTPHTKFEASVYILKKEEGGRHTGFFTNYRPQFYFRTTDVTGVVELPKGVE
MVMPGDNVTFTVELIKPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaggcgtatttgagcgcaccaaaccccacgtgaacgtggggacgatcggacac
gtagaccacgggaagaccaccctgacggcggcgattacctttgtggcggcggcggccaac
cccaacgtggaggtacaggcctacgaccagatcgataaggcccccgaggagaaggctcgc
gggattaccatcaacacggcccacgtggagtacgagaccgagaaacgccactactcgcac
gtggactgcccgggccacgccgactacgtcaagaacatgatcaccggtgcggcccagatg
gacggggccattctggtggtttcgggtaccgacggccccatgccccagacccgcgagcac
atcctgctctcgcgccaggtgggggtgccgtacatcatcgtcttcctgaacaagatcgac
atggtggacgaccccgagctgctggatctggtggagatggagattcgcgacctgctgaac
cagtacgagttccccggcgacgacacccccatcatccggggctcgggcctgaaggcgctg
gagcacatgatggcccaccccaagacccagcggggcgagaacgagtgggtggataagatc
tgggagctgctggatgccatcgactcctacattcccaccccccagcgggacgtggacaag
cccttcctgatgccggtggaggacgtgttcaccatcaccgggcgtggtaccgtggccacc
ggccggattgagcgcgggaagatcaagaccggtgatgaggtggagatcgtggggctgcgg
gagacccagaagaccgtggtgaccggggtggagatgcaccgcaagaccctgagcgaaggg
attgctggggacaacgtggggctgctcttgcggggcgtgagccgcgaagatgtggagcgg
ggccaggtgctggccaagccggggagcgtcaccccccacaccaagttcgaggcctcggtc
tacattctgaagaaggaagaagggggacggcacaccggcttcttcaccaactaccgcccg
cagttctacttccgcaccaccgatgtgaccggggtggtggagctgcccaaaggggtggag
atggtcatgcccggtgacaacgtcaccttcaccgtcgaactcatcaagcccatcgccatg
gaagaaggtctgcgcttcgccatccgtgaaggcggccgtaccgtgggcgccggtgtggtg
gcaaaaattatcgagtaa

DBGET integrated database retrieval system