KEGG   Meiothermus ruber DSM 1279: Mrub_2750Help
Entry
Mrub_2750         CDS       T01193                                 

Definition
Enoyl-CoA hydratase/isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mrb01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mrb00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mrb00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:mrb00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:mrb00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mrb00310]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:mrb00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mrb00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:mrb00410]
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:mrb00903]
Metabolism; Metabolism of terpenoids and polyketides; Geraniol degradation [PATH:mrb00281]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:mrb00362]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:mrb00627]
Metabolism; Xenobiotics biodegradation and metabolism; Caprolactam degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2788854..2789660
Genome map
AA seq 268 aa AA seqDB search
MNWQARYQRLKFAEPSEGVLEVVLSNPGRLNAADSQMHRELAYVWRDIDADPEIAAVLVR
GEGGAFSSGGDFEMIEEMIRDYETLLRVWKEARDLVYGVVNCAKPIVSAIEGPAVGAGLA
VALLADISVAGKTARIVDGHVRLGVAAGDHSVMVWPLLCGMSKAKYHLLLNEPLTGEEAE
RIGLVSRCVEDSQVYSEALRIATRLTQGAPSAIRFTKYALNNWLRMMGPNFDTSLALEFM
GFLGPDAQEGLRSLREKRPPRFQKKSPI
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaactggcaagcccgctaccagcgtctgaagtttgctgagcccagcgaaggcgtgctc
gaggtcgttctttcaaacccaggccgcctcaacgcggccgatagtcagatgcaccgtgag
ctggcctatgtctggcgggatatcgacgccgaccccgaaattgcagcggtgctggtgcgc
ggcgagggcggggccttcagcagcggcggcgacttcgagatgatcgaagagatgatccgg
gattacgaaaccttgctgcgggtctggaaggaagcccgcgatctggtgtacggggtggtg
aactgcgccaagcccatcgtgtcggccatcgaggggccggcggtgggggccgggctggcc
gtggcgctgctggccgatatcagcgtggccgggaaaaccgcccgcatcgtggacgggcat
gtgcggctgggggtggcagccggcgatcactcggtgatggtctggcctttgctgtgcggt
atgagcaaggccaagtaccacctgctgttgaacgaaccgctcaccggggaggaggccgag
cgcattgggctggtctcgcgctgcgtggaggatagccaggtctatagcgaggcgctcaga
attgcaacccggcttacccagggggccccttcagccatccgcttcaccaagtacgccctc
aacaactggctacgcatgatgggccccaacttcgacacctcgctggccctcgagtttatg
ggttttctgggccccgatgcccaggaagggctgcgctcgctgcgcgaaaaacgccctcca
cgcttccagaagaagtctcccatataa

DBGET integrated database retrieval system