KEGG   Meiothermus ruber DSM 1279: Mrub_2760Help
Entry
Mrub_2760         CDS       T01193                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
mrb  Meiothermus ruber DSM 1279
Brite
Enzymes [BR:mrb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Mrub_2760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2800695..2801384
Genome map
AA seq 229 aa AA seqDB search
MSNVLVLHGFTSHPTLTMGPLPETLRKAGFTVAQPTLPGHGTRPEDLRGVRWLDWLQTAR
EAYQALPEPRAVVGLSMGGLLAGWLAAEHKTAALVALAPALGFKNRLAYLAPLLHHVKPW
AHSTDPAEEARRRARSPNYPNFPTVALVQLIALQRRVPELLPRVRAPALVLEAAHDDTVP
EAAVRRYFALIGGPHKGYRVYQSQHDMLLDPLAQQISDDIAAWLKEKLV
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgttctggttttgcacggctttacctcccaccccaccctgaccatggggccg
ctccccgaaaccctgcgcaaggctgggtttaccgtggcccagcccaccctgcccggccac
ggcacccggcccgaggatctgcgcggtgtgcgctggctggactggctccagaccgcccgc
gaggcctatcaggcgctccccgagcccagggcggtggtgggcctctcgatgggggggctg
ctggccggctggctggccgccgagcacaagaccgccgccctggtggccctggccccggcg
ctgggcttcaagaaccgcctggcctacctggccccgctgctgcaccacgtcaaaccctgg
gcccacagcaccgaccccgccgaagaggcccggcggcgggcgcggagccccaactacccc
aactttcctaccgtggccctggtgcagttaattgcgctccagcgacgggtgcccgagctt
ttgcccagggtgcgggccccggcgctggtgctcgaggccgcccacgacgacaccgtgccg
gaagccgcggtgcggcgctattttgccctgatagggggcccccacaaggggtaccgggtc
taccagagccagcacgatatgctcctggatccgctggcccagcagatctccgacgatatc
gcggcctggctgaaagaaaagctggtgtaa

DBGET integrated database retrieval system