KEGG   Meiothermus ruber DSM 1279: Mrub_2812Help
Entry
Mrub_2812         CDS       T01193                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Mrub_2812
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mrub_2812
   00600 Sphingolipid metabolism
    Mrub_2812
Enzymes [BR:mrb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Mrub_2812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2852719..2854173
Genome map
AA seq 484 aa AA seqDB search
MQIQGYEFSISAGRLEETLGGYLLSGKTVQIGHPFGRTLYFKHGWQSWSEAGWVSLKESP
KPILPPERRPQCDDPAYALSPVHGGSGLGGLEGHDGRMLFLGALRPGARIEADRLSLKGS
SDHETQWFLAYGEQQQVLARYTELLANTLGIRGQPPAPRVWCSWYSYYSDISESKMLQTI
AALQGLPFEVFQLDDGWQQNMGDWEPNHKFPSGMSAIALRAQSQGLTPGLWLAPFIARPS
SNLFKEHPDWFLRDEQGELVLAGTNWGGYYALDVTLPAVQDWLQRLIQKVRGWGYRYLKL
DFLFAAALPGQRHSGASREEAYREALRLIREAAGDDVYILACGAPILASLGLVDGLRIGP
DVAPYWDNEDRRVYLHDPTGPAAYNALRTSLHRLWLKPLVHTDPDVAYFRTRYNLLTPAQ
RVVLQDLALVAGFKATSDPPEWLDGDEREGLKEWLEASPSILQTGPYTFKIGEREVDFSS
WLEI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
gtgcagattcagggctatgagttcagcatcagcgcggggcggctcgaggaaaccctgggc
ggctacctgctgagcggcaaaaccgtgcagatcgggcacccctttgggcgcacgctctac
ttcaagcacggctggcagagctggagcgaggccggctgggtgagcctgaaagagagcccc
aaacccatcctgccccccgagcgccgcccccagtgcgacgacccagcctacgccctctca
cctgtacacggcggcagcggcctggggggcctcgagggccacgacgggcggatgctcttc
ctgggggctctgcgtccgggggcgcgcatcgaggctgaccgcctgagcctcaagggctcg
agcgaccacgagacccagtggtttctggcctacggcgaacagcagcaggtgctggcccgc
tacaccgaactgctggctaacaccctggggatccggggccagccgcccgccccccgggtc
tggtgtagctggtacagctattacagcgatatctcagaaagcaagatgctgcagaccatc
gccgctttgcagggcctgccctttgaggtgttccagctcgacgatggctggcagcaaaac
atgggcgactgggagcccaaccacaagttcccctcgggcatgagcgctatcgccctgcgg
gcccagagccagggcctgacccccggcctctggctggccccctttattgcccggcccagc
tccaacctgttcaaggagcaccccgactggttcttgcgcgacgagcagggcgagctggtt
ctggcgggcaccaactggggcggctactacgcgctggacgtgaccctgccagcagtgcaa
gactggctgcagcgcctgatccagaaggtgcggggctggggctaccgctacttaaagctg
gacttcctgtttgcagcggccctgcccggtcaaaggcatagcggagcctcgagggaagag
gcctaccgcgaagcgctccgtctcatccgcgaggccgccggtgacgacgtgtacattctg
gcctgcggggcccccatcctcgcctcgctgggcttggtggacgggctgcgcattgggccg
gacgtggccccttactgggacaacgaagaccggcgggtgtacctgcacgaccccaccggc
cccgcggcctacaacgccctgcgcaccagcctgcaccgcctctggctgaagccgctggtg
cacaccgaccccgacgtggcctacttccgcacccgctacaacctgctcaccccggcccag
cgcgtggtgttgcaagacctggccctggtcgcgggcttcaaggccacctccgaccccccc
gagtggctggacggcgatgagcgggaagggctcaaggagtggctcgaggccagcccctcc
atcctccagaccggcccctacaccttcaaaattggcgagcgggaggtggatttctcgagc
tggctggagatctga

DBGET integrated database retrieval system