KEGG   Meiothermus ruber DSM 1279: Mrub_2812Help
Entry
Mrub_2812         CDS       T01193                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mrb00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mrb00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2852719..2854173
Genome map
AA seq 484 aa AA seqDB search
MQIQGYEFSISAGRLEETLGGYLLSGKTVQIGHPFGRTLYFKHGWQSWSEAGWVSLKESP
KPILPPERRPQCDDPAYALSPVHGGSGLGGLEGHDGRMLFLGALRPGARIEADRLSLKGS
SDHETQWFLAYGEQQQVLARYTELLANTLGIRGQPPAPRVWCSWYSYYSDISESKMLQTI
AALQGLPFEVFQLDDGWQQNMGDWEPNHKFPSGMSAIALRAQSQGLTPGLWLAPFIARPS
SNLFKEHPDWFLRDEQGELVLAGTNWGGYYALDVTLPAVQDWLQRLIQKVRGWGYRYLKL
DFLFAAALPGQRHSGASREEAYREALRLIREAAGDDVYILACGAPILASLGLVDGLRIGP
DVAPYWDNEDRRVYLHDPTGPAAYNALRTSLHRLWLKPLVHTDPDVAYFRTRYNLLTPAQ
RVVLQDLALVAGFKATSDPPEWLDGDEREGLKEWLEASPSILQTGPYTFKIGEREVDFSS
WLEI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
gtgcagattcagggctatgagttcagcatcagcgcggggcggctcgaggaaaccctgggc
ggctacctgctgagcggcaaaaccgtgcagatcgggcacccctttgggcgcacgctctac
ttcaagcacggctggcagagctggagcgaggccggctgggtgagcctgaaagagagcccc
aaacccatcctgccccccgagcgccgcccccagtgcgacgacccagcctacgccctctca
cctgtacacggcggcagcggcctggggggcctcgagggccacgacgggcggatgctcttc
ctgggggctctgcgtccgggggcgcgcatcgaggctgaccgcctgagcctcaagggctcg
agcgaccacgagacccagtggtttctggcctacggcgaacagcagcaggtgctggcccgc
tacaccgaactgctggctaacaccctggggatccggggccagccgcccgccccccgggtc
tggtgtagctggtacagctattacagcgatatctcagaaagcaagatgctgcagaccatc
gccgctttgcagggcctgccctttgaggtgttccagctcgacgatggctggcagcaaaac
atgggcgactgggagcccaaccacaagttcccctcgggcatgagcgctatcgccctgcgg
gcccagagccagggcctgacccccggcctctggctggccccctttattgcccggcccagc
tccaacctgttcaaggagcaccccgactggttcttgcgcgacgagcagggcgagctggtt
ctggcgggcaccaactggggcggctactacgcgctggacgtgaccctgccagcagtgcaa
gactggctgcagcgcctgatccagaaggtgcggggctggggctaccgctacttaaagctg
gacttcctgtttgcagcggccctgcccggtcaaaggcatagcggagcctcgagggaagag
gcctaccgcgaagcgctccgtctcatccgcgaggccgccggtgacgacgtgtacattctg
gcctgcggggcccccatcctcgcctcgctgggcttggtggacgggctgcgcattgggccg
gacgtggccccttactgggacaacgaagaccggcgggtgtacctgcacgaccccaccggc
cccgcggcctacaacgccctgcgcaccagcctgcaccgcctctggctgaagccgctggtg
cacaccgaccccgacgtggcctacttccgcacccgctacaacctgctcaccccggcccag
cgcgtggtgttgcaagacctggccctggtcgcgggcttcaaggccacctccgaccccccc
gagtggctggacggcgatgagcgggaagggctcaaggagtggctcgaggccagcccctcc
atcctccagaccggcccctacaccttcaaaattggcgagcgggaggtggatttctcgagc
tggctggagatctga

DBGET integrated database retrieval system