KEGG   Meiothermus ruber DSM 1279: Mrub_2906Help
Entry
Mrub_2906         CDS       T01193                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mrub_2906
   01230 Biosynthesis of amino acids
    Mrub_2906
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mrub_2906
  Energy metabolism
   00680 Methane metabolism
    Mrub_2906
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mrub_2906
Enzymes [BR:mrb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mrub_2906
Exosome [BR:mrb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mrub_2906
  Exosomal proteins of melanoma cells
   Mrub_2906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2941881..2942540
Genome map
AA seq 219 aa AA seqDB search
MSRVLVTFLRHGRSLSDDLRVHEGRYDAPLTEVGRAQAQQRLEEFRAKQFHFDRIISSPL
QRARAVAELMSEGLGVPLELDPDWMEQDNGKIAGLPYEEAEQRFPRPLFRSPYEKPYDGS
GESEWETYTRAARAVQNLVNRGAGSYLVVAHGKILNCALWAIFGLSPSNGTPSLRFSFAD
LGYAVLEYRPDRHTWHLDRFEMGFNSLANPLEVAPPQPG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgggttctggtcacgttcctgcgtcatggccgctccctgagcgacgacctgcgg
gtgcacgaaggccgctacgacgccccccttaccgaggtgggccgggcccaggcccagcag
cgcctggaggagtttcgcgccaagcagttccacttcgatcgcatcatctccagccccctc
cagcgggcccgcgccgtggcagagctgatgagcgaagggctgggggtgccgctggagctg
gaccccgactggatggagcaggacaacggcaaaattgccggtctcccctacgaggaagcc
gaacagcgcttccctaggcccctttttcgcagcccttacgaaaagccatacgatggcagc
ggggaaagcgagtgggaaacctatacccgcgccgccagagcggttcagaacctggtgaac
cggggtgcgggctcgtacctggtggtggctcatgggaaaatcctcaactgtgcgctgtgg
gccatttttggcctttcccccagcaacggtacgcccagcctcaggttctctttcgccgac
ctgggctatgcggtgctggagtaccggccagaccggcatacctggcatttagacaggttc
gagatgggctttaattccctagcgaacccgctcgaggtagcgccaccccagcccggctaa

DBGET integrated database retrieval system