KEGG   Meiothermus ruber DSM 1279: Mrub_2906Help
Entry
Mrub_2906         CDS       T01193                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mrub_2906
   01230 Biosynthesis of amino acids
    Mrub_2906
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mrub_2906
  Energy metabolism
   00680 Methane metabolism
    Mrub_2906
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mrub_2906
Enzymes [BR:mrb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mrub_2906
Exosome [BR:mrb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mrub_2906
  Exosomal proteins of melanoma cells
   Mrub_2906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2941881..2942540
Genome map
AA seq 219 aa AA seqDB search
MSRVLVTFLRHGRSLSDDLRVHEGRYDAPLTEVGRAQAQQRLEEFRAKQFHFDRIISSPL
QRARAVAELMSEGLGVPLELDPDWMEQDNGKIAGLPYEEAEQRFPRPLFRSPYEKPYDGS
GESEWETYTRAARAVQNLVNRGAGSYLVVAHGKILNCALWAIFGLSPSNGTPSLRFSFAD
LGYAVLEYRPDRHTWHLDRFEMGFNSLANPLEVAPPQPG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgggttctggtcacgttcctgcgtcatggccgctccctgagcgacgacctgcgg
gtgcacgaaggccgctacgacgccccccttaccgaggtgggccgggcccaggcccagcag
cgcctggaggagtttcgcgccaagcagttccacttcgatcgcatcatctccagccccctc
cagcgggcccgcgccgtggcagagctgatgagcgaagggctgggggtgccgctggagctg
gaccccgactggatggagcaggacaacggcaaaattgccggtctcccctacgaggaagcc
gaacagcgcttccctaggcccctttttcgcagcccttacgaaaagccatacgatggcagc
ggggaaagcgagtgggaaacctatacccgcgccgccagagcggttcagaacctggtgaac
cggggtgcgggctcgtacctggtggtggctcatgggaaaatcctcaactgtgcgctgtgg
gccatttttggcctttcccccagcaacggtacgcccagcctcaggttctctttcgccgac
ctgggctatgcggtgctggagtaccggccagaccggcatacctggcatttagacaggttc
gagatgggctttaattccctagcgaacccgctcgaggtagcgccaccccagcccggctaa

DBGET integrated database retrieval system