KEGG   Meiothermus ruber DSM 1279: Mrub_3029Help
Entry
Mrub_3029         CDS       T01193                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K22597  glucosylglycerate phosphorylase [EC:2.4.1.352]
Organism
mrb  Meiothermus ruber DSM 1279
Brite
Enzymes [BR:mrb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.352  glucosylglycerate phosphorylase
     Mrub_3029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459
Motif
Other DBs
NCBI-ProteinID: ADD29773
UniProt: D3PQE0
Position
3072410..3074080
Genome map
AA seq 556 aa AA seqDB search
MTAHADIHLKLKDHLEFLYPGRGQEVLEQLMALLERYPDLARPHPTPPWSEQDAILITYP
DQITQAGEPPLQTLHRFLRQHLQGAFSGVHILPFYPSTSDDGFSVVDFKQVKPGWGTWED
IQAIAADFRLMADLVCNHVSASSPWFQAFLQGDPRYQNYFITVEPGADLSQVFRPRALPL
LTPFQTQSGEKLVWTTFSTDQIDLNFAHPEVLLEVIDALLHYVRNGAQLIRLDAVGFIWK
VIGTSCIHLEGAHRIVKLMRLVLDIKAPQVVLVTETNVPHQDNIAYFGNGHDEAQMVYQF
PLPPLVLHTFRTGDASKLAAWAASLKPPSERTTFFNFLASHDGLGVVPAHGILEPEEIAA
LVQQALDHGGRVNYKDTPAGPVPYELCLTLFDALNHPHGDEDEDLKIARFLAAHAVLLSL
QGVPGVYIHSLFGSPSDHAGLAESGINRRLNRHRFTGPELAGLLSNPHSRAHRVLARLTH
LLRVRASHPAFHPSAPQVVMESREVLRILRGYRDRQVGCYINVTNQPQPIRRVGRDLISG
KYFAGSLPPYGVVWLV
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcacgccgacatacatctgaagctgaaagaccacctcgagttcctctacccc
ggccggggccaggaagtgctggagcagctcatggccctgctcgagcgctaccccgacctg
gcccggccccaccccacccccccctggagcgagcaggacgccatcctgatcacctacccc
gaccagatcacccaggccggcgaaccccccctgcaaaccctgcaccgcttcctgcgccag
cacctccagggcgccttctccggggtgcacatcctgcccttttacccctccacctccgac
gatggcttcagcgtggtggacttcaagcaggtcaagcccgggtggggcacctgggaggac
atccaggccatcgcggcggatttccggctaatggccgatctggtgtgtaaccacgtctcg
gcctcgagcccctggttccaggctttcttgcagggcgaccccaggtaccagaactacttc
atcaccgtggagcccggcgccgacctctcgcaggtcttccggccccgcgccctgcccctc
ctcacccccttccagacccaaagcggcgagaagctggtctggacgaccttctccaccgac
cagatcgacctcaatttcgctcacccggaggtgctgttggaggtaatagatgccctgctg
cactacgtgcgcaacggggcgcagctcatccgcctcgatgcggtgggctttatctggaag
gtgatcgggacaagctgcatacacctggaaggggcccaccgcatcgtcaagttgatgcgg
ctggtgctggatataaaagccccccaggtggtgctggttaccgagaccaacgtaccgcac
caggacaacatcgcgtatttcggcaacggccacgacgaggcccagatggtctaccagttc
ccgctgccccctttggtgctgcacaccttccgcaccggggacgccagcaagctggccgcc
tgggccgccagcctgaagccgccctccgagcgcaccaccttcttcaacttcctggcctcg
cacgatgggctgggggtggtgccggcccacggcattctggagcccgaagaaattgcggcc
ctcgtccagcaagccctggaccacgggggccgggtcaactacaaggacaccccggcgggc
ccggtgccctacgagctgtgcctgaccctgttcgatgccctcaatcatccccacggcgac
gaggacgaagatctcaagatcgcccgctttctggcggcccatgccgttctcctgagcttg
caaggtgtgccgggggtctacatccacagcctcttcggctcgccctccgaccacgcgggt
ctggcagaaagcgggattaaccgccgcctcaaccggcacaggttcaccgggccggagctg
gctgggctgctctccaacccccattcgcgcgcccacagggtgctggcccgcctcacccac
ctgctcagggtgcgggcttctcacccggccttccatcccagcgcgccccaggtggtgatg
gagtccagggaggtcttgcgcatcctccggggctaccgcgaccggcaggtggggtgctac
atcaacgtgaccaaccagccccagcccatccggcgggtggggcgcgacctgattagcggc
aaatacttcgccggcagcctgcctccctacggggtggtgtggctggtctga

DBGET integrated database retrieval system