KEGG   Meiothermus ruber DSM 1279: Mrub_3029Help
Entry
Mrub_3029         CDS       T01193                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mrb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3072410..3074080
Genome map
AA seq 556 aa AA seqDB search
MTAHADIHLKLKDHLEFLYPGRGQEVLEQLMALLERYPDLARPHPTPPWSEQDAILITYP
DQITQAGEPPLQTLHRFLRQHLQGAFSGVHILPFYPSTSDDGFSVVDFKQVKPGWGTWED
IQAIAADFRLMADLVCNHVSASSPWFQAFLQGDPRYQNYFITVEPGADLSQVFRPRALPL
LTPFQTQSGEKLVWTTFSTDQIDLNFAHPEVLLEVIDALLHYVRNGAQLIRLDAVGFIWK
VIGTSCIHLEGAHRIVKLMRLVLDIKAPQVVLVTETNVPHQDNIAYFGNGHDEAQMVYQF
PLPPLVLHTFRTGDASKLAAWAASLKPPSERTTFFNFLASHDGLGVVPAHGILEPEEIAA
LVQQALDHGGRVNYKDTPAGPVPYELCLTLFDALNHPHGDEDEDLKIARFLAAHAVLLSL
QGVPGVYIHSLFGSPSDHAGLAESGINRRLNRHRFTGPELAGLLSNPHSRAHRVLARLTH
LLRVRASHPAFHPSAPQVVMESREVLRILRGYRDRQVGCYINVTNQPQPIRRVGRDLISG
KYFAGSLPPYGVVWLV
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcacgccgacatacatctgaagctgaaagaccacctcgagttcctctacccc
ggccggggccaggaagtgctggagcagctcatggccctgctcgagcgctaccccgacctg
gcccggccccaccccacccccccctggagcgagcaggacgccatcctgatcacctacccc
gaccagatcacccaggccggcgaaccccccctgcaaaccctgcaccgcttcctgcgccag
cacctccagggcgccttctccggggtgcacatcctgcccttttacccctccacctccgac
gatggcttcagcgtggtggacttcaagcaggtcaagcccgggtggggcacctgggaggac
atccaggccatcgcggcggatttccggctaatggccgatctggtgtgtaaccacgtctcg
gcctcgagcccctggttccaggctttcttgcagggcgaccccaggtaccagaactacttc
atcaccgtggagcccggcgccgacctctcgcaggtcttccggccccgcgccctgcccctc
ctcacccccttccagacccaaagcggcgagaagctggtctggacgaccttctccaccgac
cagatcgacctcaatttcgctcacccggaggtgctgttggaggtaatagatgccctgctg
cactacgtgcgcaacggggcgcagctcatccgcctcgatgcggtgggctttatctggaag
gtgatcgggacaagctgcatacacctggaaggggcccaccgcatcgtcaagttgatgcgg
ctggtgctggatataaaagccccccaggtggtgctggttaccgagaccaacgtaccgcac
caggacaacatcgcgtatttcggcaacggccacgacgaggcccagatggtctaccagttc
ccgctgccccctttggtgctgcacaccttccgcaccggggacgccagcaagctggccgcc
tgggccgccagcctgaagccgccctccgagcgcaccaccttcttcaacttcctggcctcg
cacgatgggctgggggtggtgccggcccacggcattctggagcccgaagaaattgcggcc
ctcgtccagcaagccctggaccacgggggccgggtcaactacaaggacaccccggcgggc
ccggtgccctacgagctgtgcctgaccctgttcgatgccctcaatcatccccacggcgac
gaggacgaagatctcaagatcgcccgctttctggcggcccatgccgttctcctgagcttg
caaggtgtgccgggggtctacatccacagcctcttcggctcgccctccgaccacgcgggt
ctggcagaaagcgggattaaccgccgcctcaaccggcacaggttcaccgggccggagctg
gctgggctgctctccaacccccattcgcgcgcccacagggtgctggcccgcctcacccac
ctgctcagggtgcgggcttctcacccggccttccatcccagcgcgccccaggtggtgatg
gagtccagggaggtcttgcgcatcctccggggctaccgcgaccggcaggtggggtgctac
atcaacgtgaccaaccagccccagcccatccggcgggtggggcgcgacctgattagcggc
aaatacttcgccggcagcctgcctccctacggggtggtgtggctggtctga

DBGET integrated database retrieval system