KEGG   Methylobacterium radiotolerans: Mrad2831_0423Help
Entry
Mrad2831_0423     CDS       T00674                                 

Definition
putative phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mrad2831_0423
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mrad2831_0423
Enzymes [BR:mrd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Mrad2831_0423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(465997..468552)
Genome map
AA seq 851 aa AA seqDB search
MDARREPTKTRQERRDGGRADDGHDLTFVPGPLGPDSLQRIHAYWRAANYLSVGQIYLMA
NPLLREPLKPEHVKPRLLGHWGTTPGLNFIYAHLNRIIRQRALNMIAVWGPGHGAPGLVA
NAYLEGTYSEIYPDVARDAEGMERLFRQFSFPGGIPSHASPELPGSIHEGGELGYSLAHA
FGAALDNPGLIVACVVGDGEAETGPLAASWHSNKFLNPTTDGAVLPILHLNGYKIANPTL
LARMPADELRSLLVGYGYEPTFVEGDEPAAMHQAMAAALDAVLDEIAAIRHSARCGKVRL
PRCPMIVLRSPKGWTGPKAVDGKPVEGTWRSHQVPVAATRENPEHRAILEDWMRSYRPEE
LFAEDGSLVPELAVLAPKGPRRISANPHANAHKSASLRLPDLRDCAVPVPGPGRSRAEAT
RTLGGYLREVLSLNKDARNFRIMGPDETVSNRLDAVFDVTGRAWQEAMLPGDDHLLRDGR
VMEVLSEHLCEGWLEGYVLTGRHGLFATYEAFAHVVDSMVNQHAKWLKSSRDLPWRRPVP
SLNILLSSHVWRQDHNGFSHQDPGFIDFVANKRGDTARIYLPPDANTLLCVTDHCLRTYD
RINVVVAGKQPAFQWLTLDEAVTHCAAGVGIWEWASNEGETEPDLVMACAGDVPTQETLA
AVDWLRRHVPELRIRVVNVVDLMTLPAPETHPHGLDDPTFDSLFTRDRPVVFAYHGYPWL
IHRLTYKRTNHGNFHVHGFIEEGTTTTPFDMCVLNRLDRFHLAQAALRAAPRLGARGEHA
EEALRDALAAHRAYVRQTGDDLPEVRDWTWPERHAPGDHDRRIEGDIMQCGPTDTAKPGQ
AGTVDGWAVVN
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgaggcgcgagccgacgaagacccgccaggaacgccgcgatggcggccgtgcg
gacgacggtcacgacctaaccttcgtgccggggccactcggacccgacagcctgcagcgg
atccacgcctactggcgggccgcgaactacctgtcggtcggccagatctacctcatggcc
aacccgctcttgcgagagccgctgaagcccgagcacgtcaaaccaaggctcctcggccac
tggggaacgacgccgggcctcaacttcatctacgcgcacttgaaccggatcatacggcag
cgcgccctcaacatgatcgcggtttggggaccgggtcacggcgcgccggggctcgtcgcc
aacgcctacctggagggcacctacagcgagatctaccccgacgttgcgcgggacgcggaa
gggatggagcgtctgttcaggcagttctcgtttcccgggggcatcccgagtcacgcctcg
ccggagctgcccggctccatccacgagggcggcgagctcggctattccctagcccatgcg
ttcggcgcagccctggacaaccccggcctgattgtcgcctgcgtggtcggcgacggcgag
gcggagacggggccactcgccgcgtcctggcactccaacaagttcctgaatccgaccacc
gacggagccgtactgccgatcctgcacctcaacggctacaagatcgccaacccgacgctc
ctcgcccggatgcccgctgacgagcttcgcagcctcctcgtcgggtacggctacgagccg
accttcgtcgagggcgacgaaccggccgccatgcaccaggccatggcggcggccctcgac
gcggtcctcgacgagatcgcagccatccggcactccgcgcgctgcggcaaggtccggcta
ccgcgctgtccgatgattgtgctgcgcagccccaaaggttggactggaccgaaggccgtc
gatggcaagccggtcgagggaacctggcgctcgcatcaggttcccgtcgcggctacgcgg
gagaacccggagcaccgcgcgatcctggaagactggatgcgctcctaccggccggaggag
ctgttcgcggaggacggctcgctcgtaccggaactcgccgtcttggcaccgaaggggccg
cggcgcatctcggccaacccgcacgccaacgcgcacaagagcgcgtccttgcggctgccg
gacctgcgggactgcgccgtccccgtgccgggacccggccgctcccgagccgaggccacc
cgcacgctcggcggctacctgcgggaggtcctgtccctgaacaaggacgcccgcaacttc
cggatcatgggtcccgatgagaccgtctcaaaccggctggacgcggtgttcgacgtgacg
ggccgcgcctggcaggaggcgatgttgccgggcgacgatcaccttctgcgcgacggccgg
gtcatggaggtgctgagcgagcacctctgcgagggctggctcgaaggctacgtgctcacc
ggacgccacggcctgttcgcgacctacgaggccttcgcgcacgtcgtcgattcgatggtg
aatcagcacgccaagtggctgaagtcctcgcgcgacctgccctggcgccggccggtgccg
tccctgaacatcctgctctcgtcccacgtctggcggcaggaccacaacggcttcagccac
caggacccgggctttatcgacttcgtggcgaacaagcgcggtgacacggcgcggatctac
ctgccgccggacgccaatacccttctgtgcgtcacggaccactgcctccggacctatgac
cgcatcaacgtcgtcgtggccggcaagcaacccgccttccagtggctgaccctggacgag
gccgtcacacactgtgcggccggcgtcggcatctgggaatgggcctcgaacgagggcgag
acggagcccgacttggtgatggcctgcgccggggacgtgccgacgcaggagaccctcgcc
gcggtggactggctccgtcgacacgttcctgaactgcgcatccgggtggtgaacgtcgtc
gacctgatgacgctgccggcgcccgagacgcatccgcacggcctcgacgatccgaccttc
gacagcctgttcacccgggaccgtccggtggtgttcgcgtatcatggctatccgtggctc
atccaccgactgacctacaagcggacgaaccacggcaacttccacgtccacggcttcatc
gaggagggcacgacgacgacgcccttcgacatgtgcgtgctgaaccggctcgaccggttc
cacctcgcgcaggccgcgctgcgcgccgcgccgcggctgggcgcccggggtgagcacgcc
gaggaggcgctccgagacgcgctggccgcgcaccgcgcatatgtccgtcagaccggcgac
gatctgcctgaggtgcgggattggacctggccggaacggcacgcccccggggatcacgac
cgccggatcgagggcgacatcatgcagtgcggcccgaccgacacggccaagcctgggcag
gcggggacggtggacgggtgggcggtcgtaaattga

  All links  
No link information was found.   
DBGET integrated database retrieval system