KEGG   Methylobacterium radiotolerans: Mrad2831_0458Help
Entry
Mrad2831_0458     CDS       T00674                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00020  Citrate cycle (TCA cycle)
mrd00190  Oxidative phosphorylation
mrd00650  Butanoate metabolism
mrd01100  Metabolic pathways
mrd01110  Biosynthesis of secondary metabolites
mrd01120  Microbial metabolism in diverse environments
mrd01130  Biosynthesis of antibiotics
mrd01200  Carbon metabolism
Module
mrd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mrd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mrd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mrad2831_0458
   00650 Butanoate metabolism
    Mrad2831_0458
  Energy metabolism
   00190 Oxidative phosphorylation
    Mrad2831_0458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACB22469
JGI: Mrad28310458
UniProt: B1LU89
Position
494460..494879
Genome map
AA seq 139 aa AA seqDB search
MAKEEVRQDTRVSIRTPRARVRGLGVSHHGADHWWLQRLTAVANVVLMLSFVVIIAKMAG
RGYAEARLLVATPLVSILLILALLSVTVHMRLGMQVIIEDYVHAPSTKIAAVFANNAYAV
VVAVACLYAVLRIGFGQPA
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaagaggtccggcaggacacgcgcgtctcgatccgcaccccgcgcgcacgg
gtgcgcggcctcggcgtctcccatcacggcgccgaccactggtggctgcagcggctgacc
gccgtcgccaacgtcgtgctgatgctgagcttcgtggtgatcatcgccaagatggcgggc
cgcggctacgcggaggcgcggctcctcgtcgcgacccccctggtctcgatcctcctgatc
ctggcgctgctgtcggtgacggtccacatgcgcctcggcatgcaggtgatcatcgaggac
tacgtgcacgcgccgtcgacgaagatcgcggcggtgttcgccaacaacgcttacgcggtc
gtcgtggccgtcgcctgcctctacgcggtcctgcgcatcggcttcggacagccggcctga

DBGET integrated database retrieval system