KEGG   Methylobacterium radiotolerans: Mrad2831_0458Help
Entry
Mrad2831_0458     CDS       T00674                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mrd  Methylobacterium radiotolerans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:mrd01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mrd00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mrd00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:mrd00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
494460..494879
Genome map
AA seq 139 aa AA seqDB search
MAKEEVRQDTRVSIRTPRARVRGLGVSHHGADHWWLQRLTAVANVVLMLSFVVIIAKMAG
RGYAEARLLVATPLVSILLILALLSVTVHMRLGMQVIIEDYVHAPSTKIAAVFANNAYAV
VVAVACLYAVLRIGFGQPA
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaagaggtccggcaggacacgcgcgtctcgatccgcaccccgcgcgcacgg
gtgcgcggcctcggcgtctcccatcacggcgccgaccactggtggctgcagcggctgacc
gccgtcgccaacgtcgtgctgatgctgagcttcgtggtgatcatcgccaagatggcgggc
cgcggctacgcggaggcgcggctcctcgtcgcgacccccctggtctcgatcctcctgatc
ctggcgctgctgtcggtgacggtccacatgcgcctcggcatgcaggtgatcatcgaggac
tacgtgcacgcgccgtcgacgaagatcgcggcggtgttcgccaacaacgcttacgcggtc
gtcgtggccgtcgcctgcctctacgcggtcctgcgcatcggcttcggacagccggcctga

DBGET integrated database retrieval system