KEGG   Methylobacterium radiotolerans: Mrad2831_0511Help
Entry
Mrad2831_0511     CDS       T00674                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00790  Folate biosynthesis
mrd01100  Metabolic pathways
Module
mrd_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mrad2831_0511
Enzymes [BR:mrd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Mrad2831_0511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ACB22522
JGI: Mrad28310511
UniProt: B1LUE2
Position
complement(549982..550452)
Genome map
AA seq 156 aa AA seqDB search
MRAYLGIGSNVGDMAAMLDRAVTGLAAIPGIDVVARSADYRTPPWGKTDQPWFLNGAVAV
ETELDPHGLLDACLRVEHDLGRIREERWGPRVIDIDVLAYEGASIDDARLVLPHRYVRER
AFVLVPLAEIAPDLVIGGERVVDALAKLDRTGIARA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgtatctcggcatcggcagcaatgtcggcgacatggccgcgatgctcgaccgc
gcggtcaccggcctcgcggcgatcccgggcatcgacgtcgtggcgcgctcggccgactat
cggacgccgccctggggcaagaccgatcagccgtggttcctcaacggcgccgtggcggtg
gagacggagctggatccacacggcctgctcgacgcctgtctgcgggtggagcacgacctc
ggccggatccgcgaggagcgctgggggccgcgggtgatcgacatcgatgtcctggcctac
gaaggtgccagcatcgacgacgctcgcctcgtgctgccgcaccgctacgtgcgcgagcgg
gccttcgtgctggttcccctggccgagatcgcgccggacctcgtcatcggcggcgagcgc
gtggtggatgccctggcgaagctcgaccggaccggcatcgcgcgcgcctga

DBGET integrated database retrieval system