KEGG   Methylobacterium radiotolerans: Mrad2831_0675Help
Entry
Mrad2831_0675     CDS       T00674                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mrad2831_0675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ACB22686
JGI: Mrad28310675
UniProt: B1LWI4
Position
720953..721318
Genome map
AA seq 121 aa AA seqDB search
MRSLVFGAVLAVVLPLAAQAQEAGDAAAGEKAFAPCKACHNFQKNGVGPDLKGVVGRKAG
TYEGYNYSAALKNSGITWDEANLHEWLKNPKAKVPGTKMIFQGYPDDKKINDVIAYLKTQ
S
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcactcgttttcggcgccgtccttgccgtcgtcttgcccctcgccgcgcaggcc
caggaggccggtgacgccgccgccggcgagaaggcgttcgccccctgcaaggcgtgccac
aacttccagaagaacggcgtgggccccgatctgaagggcgtcgtcggccgcaaggcgggc
acctacgagggctacaactactcggccgccctgaagaactcgggcatcacctgggacgag
gccaacctgcacgagtggctgaagaacccgaaggcgaaggtgcccggcaccaagatgatc
ttccagggctaccccgacgacaagaagatcaacgacgtcatcgcctacctcaagacgcag
tcctga

DBGET integrated database retrieval system