KEGG   Methylobacterium radiotolerans: Mrad2831_0675Help
Entry
Mrad2831_0675     CDS       T00674                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
mrd  Methylobacterium radiotolerans
Pathway
Sulfur metabolism
Metabolic pathways
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mrd00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mrd02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
720953..721318
Genome map
AA seq 121 aa AA seqDB search
MRSLVFGAVLAVVLPLAAQAQEAGDAAAGEKAFAPCKACHNFQKNGVGPDLKGVVGRKAG
TYEGYNYSAALKNSGITWDEANLHEWLKNPKAKVPGTKMIFQGYPDDKKINDVIAYLKTQ
S
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcactcgttttcggcgccgtccttgccgtcgtcttgcccctcgccgcgcaggcc
caggaggccggtgacgccgccgccggcgagaaggcgttcgccccctgcaaggcgtgccac
aacttccagaagaacggcgtgggccccgatctgaagggcgtcgtcggccgcaaggcgggc
acctacgagggctacaactactcggccgccctgaagaactcgggcatcacctgggacgag
gccaacctgcacgagtggctgaagaacccgaaggcgaaggtgcccggcaccaagatgatc
ttccagggctaccccgacgacaagaagatcaacgacgtcatcgcctacctcaagacgcag
tcctga

DBGET integrated database retrieval system