KEGG   Methylobacterium radiotolerans: Mrad2831_0920Help
Entry
Mrad2831_0920     CDS       T00674                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mrad2831_0920
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mrad2831_0920
   00640 Propanoate metabolism
    Mrad2831_0920
   00660 C5-Branched dibasic acid metabolism
    Mrad2831_0920
Enzymes [BR:mrd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mrad2831_0920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
965353..966549
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKAVLKEFGLPVSRGVAIFNPSEAEAAAKELGGPVWVVKSQIHAGGRGKGTFK
GAPEGAKGGVRVTKSIDEVKQFAGEMLGQTLVTIQTGPAGKQVNRLYIEEGAQIAEEFYL
SMLVDRATGGVAFVVSTEGGMDIEAVAHDTPEKIHTIAVDPATGVMPHHGRAVAKALGLS
GAQAKEAAALTEKLYAAFVAKDMSLLEINPLVLTADGHLKCLDAKMAFDSNALYRHADIV
ALRDETEEDAKEIEASKYDLAYIALDGTIGCMVNGAGLAMATLDIIKLYGEEPANFLDVG
GGASEEKVTAAFKIITADPNVKGILVNIFGGIMKCDVIANGVIAAVKAVGLQVPLVVRLE
GTNVEQGKAIIRNSGLNVIPADDLDDAAQKIVAAVKGA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgaatatcaggccaaggccgtgctgaaggagttcggcctgcccgtctcc
cgcggcgtggccatcttcaacccgtcggaggccgaggccgccgccaaggagctcggcggt
cccgtctgggtcgtgaagagccagatccacgcgggcggccgcggcaagggcaccttcaag
ggcgcgcccgagggcgccaagggcggcgtgcgcgtcaccaagtcgatcgacgaggtcaag
cagttcgccggcgagatgctcggccagacgctggtgaccatccagaccggcccggccggc
aagcaggtcaaccgcctctacatcgaggaaggcgcccagatcgccgaggaattctacctc
tcgatgctggtcgaccgcgccacaggcggcgtcgccttcgtggtctccaccgagggtggc
atggatatcgaggcggtcgcccacgacacgcccgagaagatccacacgatcgcggtcgat
ccggccaccggcgtgatgccccaccacggccgcgccgtcgccaaggcgctcggcctgtcg
ggcgcccaggccaaggaggccgccgcgctcaccgagaagctctacgcggccttcgtggcc
aaggacatgagcctcctcgagatcaacccgctggtgctgaccgccgacgggcacctcaag
tgcctcgacgccaagatggccttcgactcgaacgccctctaccggcacgccgacatcgtc
gccctgcgcgacgagaccgaggaggacgccaaggagatcgaggcgtcgaagtacgacctc
gcctacatcgcgctcgacggcacgatcggctgcatggtcaacggcgccggcctcgccatg
gcgacgctcgacatcatcaagctctacggcgaggagccggcgaacttcctcgatgtcggc
ggcggcgcctcggaggagaaggtcacggcggcgttcaagatcatcaccgccgacccgaac
gtgaaggggatcctcgtcaacatcttcggcgggatcatgaagtgcgacgtgatcgccaac
ggcgtgatcgcggccgtgaaggcggtgggcctgcaggtgccgctggtggtgcgcctcgag
ggcaccaacgtcgagcagggcaaggccatcatccgcaattccggcctcaacgtgatcccg
gcggacgacctcgacgacgccgcccagaagatcgtcgccgccgtgaagggagcctga

DBGET integrated database retrieval system