KEGG   Methylobacterium radiotolerans: Mrad2831_0924Help
Entry
Mrad2831_0924     CDS       T00674                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00020  Citrate cycle (TCA cycle)
mrd00310  Lysine degradation
mrd01100  Metabolic pathways
mrd01110  Biosynthesis of secondary metabolites
mrd01120  Microbial metabolism in diverse environments
mrd01130  Biosynthesis of antibiotics
mrd01200  Carbon metabolism
Module
mrd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mrd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mrad2831_0924
  Amino acid metabolism
   00310 Lysine degradation
    Mrad2831_0924
Enzymes [BR:mrd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mrad2831_0924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACB22934
JGI: Mrad28310924
UniProt: B1LZN6
Position
970954..972273
Genome map
AA seq 439 aa AA seqDB search
MATDILVPTLGESVSEATIGRWFKKPGDTVAADEPIVELETDKVTLEVNAPAAGQLGEIL
VKDGETVEPGALLGSIVEAGAGAGAGKKAAPKEAAETKAESRSEAPKAAAPARAEAPAQE
SSAGYGNHGDAAAPAAQQRPVSDNGPAVAKLARESGVDPSSVNGSGKDGRVTKGDMLGAI
AKGPAPSAPAKEARPTLPRAPSAPDDAAREERVRMTKLRQTIARRLKDAQDTAAMLTTFN
DVDMSAVMAMRSQYKDIFEKKHGTKLGFMGFFTKAVIGALKDVPAVNAEIDGQDLVYKNY
YHIGIAVGTDKGLVVPVVRDADDLSIAGIEKKIAGFGKKARDGKLSIEEMQGGTFTITNG
GIYGSLMSTPILNAPQSGILGMHRIEERPVVRAGKIEARPMMYLALSYDHRIVDGKEAVT
FLVRVKEALEDPARLVLDL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgacatcctcgtcccgaccctcggcgaatccgtgagcgaggccaccatcggc
cgctggttcaagaagcccggcgacacggtcgcggccgacgagccgatcgtcgagctcgag
accgacaaggtcacgctggaggtgaacgccccggcggccggccagctcggcgagatcctg
gtcaaggacggcgagaccgtggagcccggcgccctgctcggctcgatcgtcgaggccggt
gccggtgcaggcgccggcaagaaggccgccccgaaagaggccgccgagactaaggccgag
agccggagcgaggccccgaaggccgccgcgcccgccagggccgaggccccggcccaggaa
tcctccgccggctacggcaaccacggcgacgccgccgcgcccgcggcccagcagcgtccg
gtcagcgacaacggtccggctgtggcgaagctcgcccgggagtcgggcgtcgacccgtcg
tccgtcaacgggtccggcaaggacggccgcgtcaccaagggggacatgctcggcgccatc
gccaaggggccggccccgtcggcgcccgccaaggaagcccgcccgaccctgccgcgcgcg
ccctcggcgccggacgacgccgcgcgcgaggaacgcgtgcgcatgacgaagctgcgccag
accatcgcgcgccgcctcaaggacgcgcaggacaccgcggcgatgctgacgacgttcaac
gacgtcgacatgtcggccgtgatggcgatgcgcagccagtacaaggacatcttcgagaag
aagcacggcacgaagctcggcttcatgggcttcttcaccaaggcggtgatcggcgccctc
aaggacgtgccggcggtcaacgccgagatcgacgggcaggacctcgtctacaagaactac
taccacatcggcatcgcggtcggcaccgataagggcctcgtcgtcccggtcgtgcgcgac
gccgacgacctgtcgatcgccggcatcgagaagaagatcgccggcttcggcaagaaggcc
cgcgacggcaagctctccatcgaggagatgcagggcggcaccttcacgatcaccaacggc
ggcatctacggctcgctgatgtcgacgccgatcctcaacgcgccgcaatcgggcatcctc
ggcatgcaccgcatcgaggagcgcccggtggtccgcgccggcaagatcgaggcgcggccg
atgatgtacctcgccctgtcgtacgaccatcgcatcgtcgacggtaaggaggccgtgacc
ttcctggtgcgggtcaaggaggcgctggaggatccggcgcgcctcgtgctggacctctga

DBGET integrated database retrieval system