KEGG   Methylobacterium radiotolerans: Mrad2831_0924Help
Entry
Mrad2831_0924     CDS       T00674                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mrad2831_0924
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mrad2831_0924
  Amino acid metabolism
   00310 Lysine degradation
    Mrad2831_0924
Enzymes [BR:mrd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mrad2831_0924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
970954..972273
Genome map
AA seq 439 aa AA seqDB search
MATDILVPTLGESVSEATIGRWFKKPGDTVAADEPIVELETDKVTLEVNAPAAGQLGEIL
VKDGETVEPGALLGSIVEAGAGAGAGKKAAPKEAAETKAESRSEAPKAAAPARAEAPAQE
SSAGYGNHGDAAAPAAQQRPVSDNGPAVAKLARESGVDPSSVNGSGKDGRVTKGDMLGAI
AKGPAPSAPAKEARPTLPRAPSAPDDAAREERVRMTKLRQTIARRLKDAQDTAAMLTTFN
DVDMSAVMAMRSQYKDIFEKKHGTKLGFMGFFTKAVIGALKDVPAVNAEIDGQDLVYKNY
YHIGIAVGTDKGLVVPVVRDADDLSIAGIEKKIAGFGKKARDGKLSIEEMQGGTFTITNG
GIYGSLMSTPILNAPQSGILGMHRIEERPVVRAGKIEARPMMYLALSYDHRIVDGKEAVT
FLVRVKEALEDPARLVLDL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgacatcctcgtcccgaccctcggcgaatccgtgagcgaggccaccatcggc
cgctggttcaagaagcccggcgacacggtcgcggccgacgagccgatcgtcgagctcgag
accgacaaggtcacgctggaggtgaacgccccggcggccggccagctcggcgagatcctg
gtcaaggacggcgagaccgtggagcccggcgccctgctcggctcgatcgtcgaggccggt
gccggtgcaggcgccggcaagaaggccgccccgaaagaggccgccgagactaaggccgag
agccggagcgaggccccgaaggccgccgcgcccgccagggccgaggccccggcccaggaa
tcctccgccggctacggcaaccacggcgacgccgccgcgcccgcggcccagcagcgtccg
gtcagcgacaacggtccggctgtggcgaagctcgcccgggagtcgggcgtcgacccgtcg
tccgtcaacgggtccggcaaggacggccgcgtcaccaagggggacatgctcggcgccatc
gccaaggggccggccccgtcggcgcccgccaaggaagcccgcccgaccctgccgcgcgcg
ccctcggcgccggacgacgccgcgcgcgaggaacgcgtgcgcatgacgaagctgcgccag
accatcgcgcgccgcctcaaggacgcgcaggacaccgcggcgatgctgacgacgttcaac
gacgtcgacatgtcggccgtgatggcgatgcgcagccagtacaaggacatcttcgagaag
aagcacggcacgaagctcggcttcatgggcttcttcaccaaggcggtgatcggcgccctc
aaggacgtgccggcggtcaacgccgagatcgacgggcaggacctcgtctacaagaactac
taccacatcggcatcgcggtcggcaccgataagggcctcgtcgtcccggtcgtgcgcgac
gccgacgacctgtcgatcgccggcatcgagaagaagatcgccggcttcggcaagaaggcc
cgcgacggcaagctctccatcgaggagatgcagggcggcaccttcacgatcaccaacggc
ggcatctacggctcgctgatgtcgacgccgatcctcaacgcgccgcaatcgggcatcctc
ggcatgcaccgcatcgaggagcgcccggtggtccgcgccggcaagatcgaggcgcggccg
atgatgtacctcgccctgtcgtacgaccatcgcatcgtcgacggtaaggaggccgtgacc
ttcctggtgcgggtcaaggaggcgctggaggatccggcgcgcctcgtgctggacctctga

DBGET integrated database retrieval system