KEGG   Methylobacterium radiotolerans: Mrad2831_0998Help
Entry
Mrad2831_0998     CDS       T00674                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
mrd  Methylobacterium radiotolerans
Brite
Enzymes [BR:mrd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Mrad2831_0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1053034..1054092)
Genome map
AA seq 352 aa AA seqDB search
MSQETYSDRDRSFALAKRSHDLIRDYGPSATPRAYAVWYAYVSGELPLLADAVKRLTTQN
GCLTEGDIDDLHETYLDGRRLASTTDDVSRVVLSEIAAVTEILDLSLGSTAQYSESLRGV
AQDLSQGVPSRARFGEIVATLAATTREVAANNRILEARMRETRSEIETLREKLDATRRES
LTDALTGLANRKHFEETLKASMETARARTTPMSLIILDIDFFKRFNDLYGHLTGDQVLRL
VAIVMRENAGKQAQLARFGGEEFGIILPGVDRAVAKQVAETVRTSVMGRELVKRSTGESL
GKITISLGVAVLRPGDTPASLMERADLCMFAAKRAGRNRFLDDAAESLSQVA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggagacctattcggatcgcgatcgcagcttcgcgctggcgaagcgcagccac
gatctgattcgcgactacggcccctccgcgacgccgcgcgcctacgccgtctggtacgcc
tacgtctcgggggagctgccgctcctcgccgacgccgtgaagcgcctcaccacccagaat
ggctgcctcaccgagggcgacatcgacgacctgcacgagacctatctcgacgggcgccgc
ctcgcgagcaccaccgacgacgtcagccgcgtcgtcctcagcgagatcgcggccgtcacc
gagatcctggacctctccctgggctcgacggcgcagtacagcgagtccctgcgcggggtc
gcgcaggatctctcccagggcgtcccgagccgggcgcggttcggcgagatcgtcgcgacc
ctggccgcgacgacccgggaggtcgccgccaacaaccggatcctcgaagcccgcatgcgc
gagacccgcagcgagatcgagaccctgcgcgagaagctcgacgcgacccggcgcgagagc
ctgaccgacgccctgacggggctggcgaaccgcaagcatttcgaggagacgctgaaggcg
tccatggagacggcccgggcgcgcacgacgcccatgagcctgatcatcctcgacatcgac
ttcttcaagcgcttcaacgacctgtacggtcatctcacgggcgaccaggtcctgcggctc
gtggcgatcgtgatgcgcgagaacgccggcaagcaggcgcagctcgcccggttcggcggc
gaggagttcgggatcatcctgcccggcgtcgaccgggcggtggccaagcaggtggccgag
acggtgcgcaccagcgtcatggggcgcgagctcgtcaagcgctcgaccggcgagtcgctc
ggcaagatcacgatctccctgggtgtcgcggtgctgcgcccgggcgacacgccggcctcg
ctgatggagcgggccgacctgtgcatgttcgccgcgaagcgcgcgggccggaaccgcttc
ctggacgacgccgccgagtcgctgtcgcaggtggcctga

DBGET integrated database retrieval system