KEGG   Methylobacterium radiotolerans: Mrad2831_1010Help
Entry
Mrad2831_1010     CDS       T00674                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00240  Pyrimidine metabolism
mrd00250  Alanine, aspartate and glutamate metabolism
mrd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mrad2831_1010
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mrad2831_1010
Enzymes [BR:mrd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Mrad2831_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACB23019
JGI: Mrad28311010
UniProt: B1M0P9
Position
1066849..1067853
Genome map
AA seq 334 aa AA seqDB search
MSATQPCPPGAPHLHPGLIMTTPPPPAFPHRHLLGIEGLTRPDIEVLLDAAESAVDISRQ
VEKKRTTLRGRTQINLFFEPSTRTQSSFELAGKRLGADVMNMSVASSSVKKGETLIDTAA
TLNAMRPDIIVVRHESAGAVHLLARKVDCAVVNAGDGAHEHPTQALLDALTIRRNKGRIE
GLQVAICGDVLHSRVARSNIILLQAMGARVRLIAPSTLLPAGIERFGVETFTDMRRGLVG
CDIVMMLRLQRERMNGSFVPSVKEYFRYFGLDGEKLALAKPDALVMHPGPMNRGVEISSE
IADGAQSLIREQVEMGVAVRMAVLEALARHLPNG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgacacagccttgcccgccgggcgcgccgcacctacacccgggcctcatcatg
acgacgcctccgcccccggccttcccgcaccggcacctcctcggcatcgagggcctgacc
cggcccgatatcgaggtgctgctcgacgccgccgaatccgccgtcgacatctcgcggcag
gtggagaagaagcgcacgaccctgcggggccgcacgcagatcaacctgttcttcgagccc
tcgacccggacgcaatcgtccttcgagctcgccgggaagcgactcggcgccgacgtcatg
aacatgtcggtggcctcgtcctcggtgaagaagggcgagaccctgatcgacaccgccgcg
acgctcaacgccatgcggcccgacatcatcgtggtccgccacgaatcggccggcgcggtg
cacctgctcgcccgcaaggtcgattgcgcggtggtcaatgccggcgacggcgcccacgag
cacccgacccaggcgctcctcgacgcgctcaccatccgccgcaacaagggccggatcgag
gggctgcaggtggcgatctgcggcgacgtcctgcactcgcgggtggcgcgctccaacatc
atcctgctgcaggcgatgggcgcgcgggtccgcctgatcgcgccctcgacgctgctgccc
gccggcatcgagcgcttcggcgtcgagaccttcaccgacatgcgcaggggcctcgtcggc
tgcgacatcgtgatgatgctgcgcctccagcgggagcgcatgaacggctcgttcgtgccc
tcggtgaaggagtatttccggtacttcggcctcgacggcgagaagctggcgctcgccaag
cccgacgccctggtgatgcatccgggcccgatgaaccgcggcgtcgagatctcctccgag
atcgccgacggcgcgcagtcgctgatccgcgagcaggtcgagatgggcgtggccgtccgc
atggccgtgctggaggcgctggcgcggcacctgccgaacgggtga

DBGET integrated database retrieval system