KEGG   Methylobacterium radiotolerans: Mrad2831_1098Help
Entry
Mrad2831_1098     CDS       T00674                                 

Definition
sulfate ABC transporter permease
Orthology
K02047  
sulfate transport system permease protein
Organism
mrd  Methylobacterium radiotolerans
Pathway
Sulfur metabolism
ABC transporters
Module
Sulfate transport system
Sulfate-sulfur assimilation
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mrd00920]
Environmental Information Processing; Membrane transport; ABC transporters [PATH:mrd02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1154922..1155803
Genome map
AA seq 293 aa AA seqDB search
MSEIFSPAFVPAAKPAPVASEGAGVRAVLIGIAVAFLALFLVLPLFAVFLQAFSKGIDAF
LDAFREPDAWSAIRLTLTVAAIAVPFNVVFGLAASWAIAKFEFPGKSLLITLIDLPFSVS
PVVSGMIYVLLFGSQGLFGSWLIDHGIQILFALPGIVLATVFVTFPFVARELIPLMQEQG
TAEEEAALTLGASGLHAFRTVTLPNIRWGLLYSVLLCNARAMGEFGAVSVVSGHIRGLTN
TIPLHVEILYNEYNFVAAFAVASLLAVLALITLVLKSVLEWRFAGELAHGRAH
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagatcttctcccccgccttcgtgccggctgccaagccggccccggtcgcgtcg
gagggggccggcgtccgcgcggtcctgatcggcatcgccgtggcgttcctggcgctgttc
ctggtgctgccgctgttcgcggtcttcctccaggccttctcgaaggggatcgacgccttc
ctggacgccttccgggagcccgatgcctggagcgcgatccgcctgacgctgaccgtggcg
gcgatcgcggtgccgttcaacgtcgtgttcgggctggccgcctcctgggccatcgccaag
ttcgagtttcccggcaagtcgctgctgatcaccctgatcgaccttccgttctcggtctcg
ccggtggtctcggggatgatctacgtgctgctgttcgggtcccagggcctgttcggatcc
tggctcatcgatcacggcatccagatcctgttcgccctgccggggatcgtgctggcgacg
gtgttcgtcaccttcccgttcgtcgcccgcgagctgatcccgctgatgcaggagcagggc
accgccgaggaggaggcggcgctgacgctgggcgcctcgggcctgcacgcgttccggacg
gtgacgctgcccaatatccgctggggcctgctctacagcgtgctcctctgcaatgcccgg
gcgatgggcgagttcggagcggtgtcggtggtgtcgggccacatccgcggcctgaccaac
actatcccactccacgtggagatcctctacaatgagtacaacttcgtcgccgcattcgcc
gtcgcttcgctcctcgccgtccttgccctcatcaccctcgtcctcaaatccgtcctcgag
tggcgcttcgcaggcgagctcgcgcacggccgggcgcactga

DBGET integrated database retrieval system