KEGG   Methylobacterium radiotolerans: Mrad2831_1098Help
Entry
Mrad2831_1098     CDS       T00674                                 

Definition
(GenBank) sulfate ABC transporter, inner membrane subunit CysW
  KO
K02047  
sulfate transport system permease protein
Organism
mrd  Methylobacterium radiotolerans
Pathway
Sulfur metabolism
ABC transporters
Module
Sulfate transport system
Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Mrad2831_1098
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Mrad2831_1098
Transporters [BR:mrd02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfate transporter [MD:M00185] [OT]
    Mrad2831_1098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1154922..1155803
Genome map
AA seq 293 aa AA seqDB search
MSEIFSPAFVPAAKPAPVASEGAGVRAVLIGIAVAFLALFLVLPLFAVFLQAFSKGIDAF
LDAFREPDAWSAIRLTLTVAAIAVPFNVVFGLAASWAIAKFEFPGKSLLITLIDLPFSVS
PVVSGMIYVLLFGSQGLFGSWLIDHGIQILFALPGIVLATVFVTFPFVARELIPLMQEQG
TAEEEAALTLGASGLHAFRTVTLPNIRWGLLYSVLLCNARAMGEFGAVSVVSGHIRGLTN
TIPLHVEILYNEYNFVAAFAVASLLAVLALITLVLKSVLEWRFAGELAHGRAH
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagatcttctcccccgccttcgtgccggctgccaagccggccccggtcgcgtcg
gagggggccggcgtccgcgcggtcctgatcggcatcgccgtggcgttcctggcgctgttc
ctggtgctgccgctgttcgcggtcttcctccaggccttctcgaaggggatcgacgccttc
ctggacgccttccgggagcccgatgcctggagcgcgatccgcctgacgctgaccgtggcg
gcgatcgcggtgccgttcaacgtcgtgttcgggctggccgcctcctgggccatcgccaag
ttcgagtttcccggcaagtcgctgctgatcaccctgatcgaccttccgttctcggtctcg
ccggtggtctcggggatgatctacgtgctgctgttcgggtcccagggcctgttcggatcc
tggctcatcgatcacggcatccagatcctgttcgccctgccggggatcgtgctggcgacg
gtgttcgtcaccttcccgttcgtcgcccgcgagctgatcccgctgatgcaggagcagggc
accgccgaggaggaggcggcgctgacgctgggcgcctcgggcctgcacgcgttccggacg
gtgacgctgcccaatatccgctggggcctgctctacagcgtgctcctctgcaatgcccgg
gcgatgggcgagttcggagcggtgtcggtggtgtcgggccacatccgcggcctgaccaac
actatcccactccacgtggagatcctctacaatgagtacaacttcgtcgccgcattcgcc
gtcgcttcgctcctcgccgtccttgccctcatcaccctcgtcctcaaatccgtcctcgag
tggcgcttcgcaggcgagctcgcgcacggccgggcgcactga

DBGET integrated database retrieval system