KEGG   Methylobacterium radiotolerans: Mrad2831_1114Help
Entry
Mrad2831_1114     CDS       T00674                                 

Definition
(GenBank) alpha/beta hydrolase fold
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mrad2831_1114
Enzymes [BR:mrd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Mrad2831_1114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Peptidase_S9 Abhydrolase_4 Esterase
Motif
Other DBs
NCBI-ProteinID: ACB23123
JGI: Mrad28311114
UniProt: B1M1T8
Position
complement(1171086..1172129)
Genome map
AA seq 347 aa AA seqDB search
MRPVRRFDGDTGREPPLLTLRSTPDNPVPPGGTLIAVGTRDDCTLRAAYWQTTARTCRGT
VCLLQGRAEFIEKYYETIHELRARGFAVVAFDWRGQGESDRRVDDPHKGHVARFDDYRLD
LRAVAETILVPLMPEPHVGLAHSMGGCVALLAALDGALPFRRLVTLAPMLSIRMIRWPAG
AAILSRGLQRLGLGSRYIPFGKPVSIATNPYAGNRLSRDPVRYARNAAAARQVGAGAVGD
PTIAWLAEAFRAMARLRDPRAAPRIGLPTLIVAAGADPVCGTADTERFAARLKAGHILVL
PDSRHEILTERDAIRQDFWAAFEAFVPGSPLPTHAEVEAHAVAVPVA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgaggccagtgagacgcttcgacggtgataccgggcgcgagccgccgctcctgaccctg
cgcagcacgcccgacaacccggtcccgccgggcggcacgctgatcgccgtcggcacgcgc
gacgactgcaccctgcgggcggcctactggcagacgacggcgcgcacctgccggggcacc
gtctgcctgctccagggccgggccgagttcatcgagaagtactacgagacgatccacgag
ctgcgcgcccggggcttcgcggtcgtcgccttcgactggcgcggccagggcgaatcggac
cggcgggtggacgatccgcacaagggccacgtcgcccgattcgacgattaccgcctcgac
ctgcgggccgtggccgagacgatcctggtgccgctgatgcccgagccccatgtcggcctc
gcccattccatgggcggatgcgtcgccctcctcgcggccctcgacggcgcgctgccgttc
cggcggctggtgaccctggcgccgatgctgtcgatccggatgatccgctggccggccggc
gccgcgatcctgtcgcgggggctgcagcggctcggcctcgggagccgctacatcccgttc
ggcaagccggtctcgatcgccaccaacccgtacgccggcaaccgcctgtcgcgcgatccc
gtccgctacgcccgcaacgccgcggcggcccggcaggtcggcgccggcgcggtcggcgac
ccgacgatcgcctggctcgccgaggcgttccgcgcgatggcgcggctgcgcgacccgcgg
gcggcgccgcggatcgggctgccgaccctgatcgtcgcggcgggcgccgacccggtctgc
ggcacggcggacaccgagcgcttcgccgcccggctgaaggccggccatatcctggtcctg
ccggattcccggcacgagatcctgaccgagcgcgacgcgatccggcaggatttctgggcg
gccttcgaggccttcgtgccgggctcgcccctgccgacccacgcggaggtcgaggcgcac
gccgtcgcggttccggtcgcctga

DBGET integrated database retrieval system