KEGG   Methylobacterium radiotolerans: Mrad2831_1479Help
Entry
Mrad2831_1479     CDS       T00674                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
mrd  Methylobacterium radiotolerans
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mrd00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:mrd00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1544271..1545680
Genome map
AA seq 469 aa AA seqDB search
MAAISFFGDLLQTISERGRDLIGIGRGDMGSRASAGDLVKLCEDLISRRGEASGVALARL
ILDRYASFGQAERHAFLRAIALDFDADHAAVDEAIAAYRAAPSRARLGSLHEAAEPRSQE
LIRRLNLARGGTLSLVRMREDLFDLRRALRAGDEADPALMDAVDSLDCDFEHLFASWFNR
GFLVLRHIDWTTPAHILEKIIRYEAVHAISGWDDLRARIEPPDRRCFAFFHPALADEPLI
FVEVALTDQIAPAIAPILSQERKPLQPHAATTAVFYSISNCQKGLAGVTFGNFLIKQVVE
DLTREVPTLKTFVTLSPVPGFAAWLARERRADSPQGLLPEDVETLRALDDPAWPADKARA
ETVRRALIPAAAAYFLRAKNERGRPLDPVARFHLGNGARLDRINFLGDTSKKGLAQSHGL
MVNYLYDLAAIERNHETYANLGTVVAAPAVTRELRAKLPPPRAVVLAEA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgatctccttcttcggcgacctgcttcagaccatcagcgagcgcggccgcgac
ctgatcgggatcggccgcggcgacatgggatcccgggccagcgccggcgacctcgtgaag
ctgtgcgaggacctgatctcccggcgcggcgaggcctccggggtggcgctggcccgcctg
atcctcgaccgctacgcgagcttcggccaggccgagcgccacgccttcctgcgggccatc
gccctcgacttcgacgcagaccacgccgccgtcgacgaggcgatcgccgcctaccgcgcc
gccccctcccgcgcccgcctcggcagcctgcacgaggccgccgagccgcgcagccaggag
ctgatccgccgcctcaacctcgcccgcggcggcacgctcagcctcgtgcggatgcgcgag
gacctgttcgacctgcgccgggcgctgcgcgccggcgacgaggccgacccggccctgatg
gacgccgtcgacagcctcgactgcgacttcgagcacctgttcgcctcgtggttcaaccgc
ggcttcctggtgctgcgccacatcgactggacgacgccggcgcacatcctggagaagatc
atccgctacgaggcggtgcacgccatctccggctgggacgacctgcgcgcccgcatcgag
ccgccggaccggcgctgcttcgcgttcttccacccggcgctcgccgacgagccgctgatc
ttcgtggaggtggcgctcaccgaccagatcgccccggcgatcgccccgatcctgtcgcag
gagcgcaagccgctgcagccgcacgccgccaccacggcggtgttctactcgatctcgaac
tgccagaagggcctcgccggcgtcaccttcggcaacttcctgatcaagcaggtggtcgag
gacctgacccgcgaggtcccgacgctcaagaccttcgtgacgctctcgccggtgccgggc
ttcgccgcgtggctggcgcgggagcgccgggccgacagcccgcagggcctgctgcccgag
gatgtcgagaccctgcgggcgctggacgacccggcctggccggccgacaaggcccgggcc
gagacggtgcgccgggcgctgatcccggcggcggccgcctatttcctgcgcgccaagaac
gagcgcgggcgccccctcgacccggtggcccggttccatctcggcaacggcgcgcgcctc
gaccggatcaacttcctgggcgacacgtccaagaaggggctggcccagtcccacggcctg
atggtcaactacctgtacgacctcgccgccatcgagcggaaccacgagacctacgccaat
ctcggcaccgtggtggcggccccggcggtgacccgggagctgcgcgccaagctgccgccg
ccccgggccgtggtgctcgccgaggcgtag

DBGET integrated database retrieval system