KEGG   Methylobacterium radiotolerans: Mrad2831_1541Help
Entry
Mrad2831_1541     CDS       T00674                                 

Definition
(RefSeq) pyridoxal-5'-phosphate-dependent protein subunit beta
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mrad2831_1541
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mrad2831_1541
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mrad2831_1541
Enzymes [BR:mrd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mrad2831_1541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1624843..1625982)
Genome map
AA seq 379 aa AA seqDB search
MPPSAAYLDPATGATYPIETPRWRSETGGPLMITDLPGIGRGEIDTGQRSLWRYAAALPV
AVADPVTLGEGCTPLVRRPWRGGHAHFKLEWFAPSGSFKDRGASVMLSILRQQGIDAVLE
DSSGNGGAAVATYAAAAGMRAKILVPASTSPAKTVQMRAVGAEVELIPGTRQDTADAAVA
QADSIFYASHNWQAHFLQGTKTLAYELWEDLGFAAPDHVIIPCGAGSNILGCDIGFSELL
RRGAIARLPRLYAVQPAHCAPLHAGFEAGAADFVPVTPRPTLAEGASIAQPVRGRAVLAA
LRRSGGGTVAVSEAAIEAALMELARSGLYVEPTCAMAAAALTDLTARGAIRPEDTTVVVL
TGTGIKATPRIAELLGLAP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgtccgccgcctatctcgaccccgccaccggggcgacctacccgatcgagacg
ccgcgctggcgctcggagacgggcggtccgctgatgatcaccgacctgccggggatcggg
cgcggcgagatcgacacgggccagcgctccctctggcgctacgccgccgccctgccggtg
gcggtggccgacccggtcacgctgggggagggctgcacgccgctggtgcgccggccctgg
cggggcgggcacgcgcatttcaagctcgaatggttcgcgccctcgggcagcttcaaggac
cggggcgcctccgtgatgctgtcgatcctgcgccagcaggggatcgacgcggtgctggag
gattcctccggcaatggcggggccgcggtggcgacctacgcggcggcggccgggatgcgg
gccaagatcctggtcccggcctcgacctcgccggccaagaccgtgcagatgcgcgccgtc
ggcgcggaggtcgagctgatccccggcacccgccaggacaccgccgacgcggccgtcgcc
caggcggactcgatcttctacgccagccacaactggcaggcccacttcctccagggcacc
aagacgctggcctacgagctgtgggaggatctgggtttcgccgcgcccgaccatgtcatc
atcccctgcggcgcgggcagcaacatcctcggctgcgacatcggcttctcggagctgctg
cgccggggcgcgatcgcccgtctgccgcggctctacgcggtccagccggcccactgcgcg
cccctgcacgcgggcttcgaggccggcgcggcggatttcgtgccggtcaccccgcgcccg
acgctggccgagggcgcctcgatcgcccagccggtccgcggccgggcggtgctggcggcg
ctccgccgctccggcggcggcaccgtggcggtctccgaggcagccatcgaggcggcgctg
atggagctcgcccgctcgggcctctacgtcgagccgacctgcgccatggcggcggcggcg
ctcaccgatctcaccgcgcgcggcgcgatccggcccgaggacaccaccgtggtggtgctc
accggcaccggcatcaaggcgacgccgcgcatcgccgagcttctgggcctcgccccgtaa

DBGET integrated database retrieval system