KEGG   Methylobacterium radiotolerans: Mrad2831_1541Help
Entry
Mrad2831_1541     CDS       T00674                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00260  Glycine, serine and threonine metabolism
mrd00750  Vitamin B6 metabolism
mrd01100  Metabolic pathways
mrd01110  Biosynthesis of secondary metabolites
mrd01120  Microbial metabolism in diverse environments
mrd01230  Biosynthesis of amino acids
Module
mrd_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mrad2831_1541
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mrad2831_1541
Enzymes [BR:mrd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mrad2831_1541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NmrA
Motif
Other DBs
NCBI-ProteinID: ACB23536
JGI: Mrad28311541
UniProt: B1M5E5
Position
complement(1624843..1625982)
Genome map
AA seq 379 aa AA seqDB search
MPPSAAYLDPATGATYPIETPRWRSETGGPLMITDLPGIGRGEIDTGQRSLWRYAAALPV
AVADPVTLGEGCTPLVRRPWRGGHAHFKLEWFAPSGSFKDRGASVMLSILRQQGIDAVLE
DSSGNGGAAVATYAAAAGMRAKILVPASTSPAKTVQMRAVGAEVELIPGTRQDTADAAVA
QADSIFYASHNWQAHFLQGTKTLAYELWEDLGFAAPDHVIIPCGAGSNILGCDIGFSELL
RRGAIARLPRLYAVQPAHCAPLHAGFEAGAADFVPVTPRPTLAEGASIAQPVRGRAVLAA
LRRSGGGTVAVSEAAIEAALMELARSGLYVEPTCAMAAAALTDLTARGAIRPEDTTVVVL
TGTGIKATPRIAELLGLAP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgtccgccgcctatctcgaccccgccaccggggcgacctacccgatcgagacg
ccgcgctggcgctcggagacgggcggtccgctgatgatcaccgacctgccggggatcggg
cgcggcgagatcgacacgggccagcgctccctctggcgctacgccgccgccctgccggtg
gcggtggccgacccggtcacgctgggggagggctgcacgccgctggtgcgccggccctgg
cggggcgggcacgcgcatttcaagctcgaatggttcgcgccctcgggcagcttcaaggac
cggggcgcctccgtgatgctgtcgatcctgcgccagcaggggatcgacgcggtgctggag
gattcctccggcaatggcggggccgcggtggcgacctacgcggcggcggccgggatgcgg
gccaagatcctggtcccggcctcgacctcgccggccaagaccgtgcagatgcgcgccgtc
ggcgcggaggtcgagctgatccccggcacccgccaggacaccgccgacgcggccgtcgcc
caggcggactcgatcttctacgccagccacaactggcaggcccacttcctccagggcacc
aagacgctggcctacgagctgtgggaggatctgggtttcgccgcgcccgaccatgtcatc
atcccctgcggcgcgggcagcaacatcctcggctgcgacatcggcttctcggagctgctg
cgccggggcgcgatcgcccgtctgccgcggctctacgcggtccagccggcccactgcgcg
cccctgcacgcgggcttcgaggccggcgcggcggatttcgtgccggtcaccccgcgcccg
acgctggccgagggcgcctcgatcgcccagccggtccgcggccgggcggtgctggcggcg
ctccgccgctccggcggcggcaccgtggcggtctccgaggcagccatcgaggcggcgctg
atggagctcgcccgctcgggcctctacgtcgagccgacctgcgccatggcggcggcggcg
ctcaccgatctcaccgcgcgcggcgcgatccggcccgaggacaccaccgtggtggtgctc
accggcaccggcatcaaggcgacgccgcgcatcgccgagcttctgggcctcgccccgtaa

DBGET integrated database retrieval system