KEGG   Methylobacterium radiotolerans: Mrad2831_1588Help
Entry
Mrad2831_1588     CDS       T00674                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mrad2831_1588
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mrad2831_1588
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mrad2831_1588
Enzymes [BR:mrd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mrad2831_1588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1675169..1676581
Genome map
AA seq 470 aa AA seqDB search
MLHVSTRGEAAPLSFSDALLAGLARDGGLYVPQTWPQIGHSEIAALAGRPYAEAAKRVLR
PLIDGDIAGPDLDRMIDAAYATFRHPAVCPLTQLDDNLFLLELFHGPTLAFKDVAMQLLG
RLMDHVLAERGARATIVGATSGDTGSAAVEAFGGLDRVDVFILYPHGRVSEVQRRQMTSV
PAQNVHALAVDGTFDDCQNLVKALFQHADFADAVRLSGVNSINWARVAAQAVYYFTSAVA
LGAPHRPVSFAVPTGNFGDVLAGWVAKQMGLPVGRLMIGTNANDILVRTLEHGAYELRGV
VPTTSPSMDIQISSNFERLLFEALGRDASSLSRLMAGLKQSGGFSLSPEVLATVRSEFDA
VAVPEPDVMAEIALTQAATGVVLDPHSAIGVRAGRRLLEQDPATPVVALATAHPAKFPDA
VARATGGLRPALPPHLADLMDRPERLTRVANDQAALEALIRERARIARGA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgctccacgtctcgactcgcggcgaggccgcgccgctctcgttctcggacgcgctcttg
gcgggcctcgcccgcgacggcgggctctacgtgccgcagacctggccgcagatcggccat
tcggagatcgccgccctggcgggccggccctacgcggaggccgccaagcgggtgctgcgc
ccgctgatcgacggcgacatcgccgggccggacctcgaccggatgatcgacgccgcctac
gcgacgttccgccacccggcggtctgccccctgacccagctcgacgacaacctgttcctg
ctggaactcttccacgggccgacgctcgccttcaaggacgtggcgatgcagctgctcggg
cggctgatggaccacgtcctggccgagcgcggcgcccgcgccaccatcgtgggcgcgacc
tcgggcgacaccggctcggccgccgtggaggccttcggcggcctcgaccgggtcgacgtg
ttcatcctctacccgcacgggcgcgtctcggaggtgcagcggcggcagatgacctcggtg
ccggcgcagaacgtccacgcgctggccgtcgacggcacgttcgacgattgccagaacctc
gtcaaagccctgttccagcacgccgatttcgccgatgcggtgcggctgtcgggggtcaac
tcgatcaactgggcccgggtcgccgcgcaggcggtctactacttcaccagcgcggtggcg
ctgggcgcgccccaccggccggtctccttcgcggtgccgaccggcaatttcggcgacgtg
ctcgccggctgggtcgccaagcagatgggcctgccggtcgggcggctgatgatcggcacc
aacgccaacgacatcctggtgcgcaccctggagcacggcgcctacgagctgcgcggcgtg
gtccccaccacctccccctccatggacatccagatttcctcgaatttcgagcgtctgctg
ttcgaggcgctcgggcgcgacgcctcgtccctgtcgcggctgatggccgggctgaagcag
tccggcggcttctcgctgagccccgaggtgctggccacggtccggtccgagttcgacgcc
gtcgcggtgccggagcccgacgtcatggcggagatcgccctgacccaggccgccaccggc
gtggtgctcgatccccacagcgccatcggcgtgcgcgccgggcgccgcctcctggagcag
gatccggcgaccccggtggtggcgctggccaccgcgcatcccgcgaaattcccggacgcg
gtcgccagggccacgggcggcctgcgccccgccctgcccccgcacctcgccgacctgatg
gaccggcccgagcgcctgacccgggtggccaacgaccaggccgccctggaggcgctgatc
cgcgagcgcgcccgcatcgcgaggggcgcgtga

DBGET integrated database retrieval system