KEGG   Methylobacterium radiotolerans: Mrad2831_1600Help
Entry
Mrad2831_1600     CDS       T00674                                 

Definition
putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase (EC:2.4.1.25 5.4.99.15)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
K06044  
(1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase [EC:5.4.99.15]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mrd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1700046..1704947)
Genome map
AA seq 1633 aa AA seqDB search
MSALEQLADLVGVAAGYTDAFGKPVETPLEVRRGLLAALGFAVEDEAAIAGSLAEVERLR
RGLIPPLLPVEARRAARVPVRPQNGAPHTLVWRLVDERGTAREGRANPQGSEPSFELPPL
TPGYHRLIVQAGPTRTESWVIAAPQRCWRPRPYTEEGASDWGLAAQLYGLRSATNIGIGT
YADAGEAAREAALRGAAFLGLSPVHALFGSDRTKISPYSPSSRLFLETLFIAPRSLPGLA
GSRAEALLAERADAITALREAALVDHQGVHDVLDPVLRALWAESPARAGTDAGFEQFRQE
GGEDLESHALFEALSEHFRQRGAHWLGDWPEDYRRAGTDAVRAFAAENADLVGYHAWLQY
LADRQLAEASAAALGAGMRVGLYRDLAVGADRGGSEIWSHPERFADRVSIGAPPDLLAPK
GQNWGLPAFDPLAMERDGLAAFRALVQANMRHAGAIRIDHAFQLARLFLIPLGAGAQAGA
YVAMPFEPMLAVLRLESHRNKCLVIAEDLGTAPEGFSDALMRAGVLSYRILAFEREGDGR
FKPPAAYPRDALTAITTHDLPTFVGWWRGVDTDTRQSLGLYDQERAEAERGERVVERRRL
AEALAAEQLIPSAEPPDAAPFEAAARYLARAPAMLTAVQYEDVVSELAQANVPGSTEGYP
NWRRKLDRDLADIAAPGGPLAKLAAALSAEARGPRSGAARLAAPPPRATYRLQFHKDFTF
ADAGKIIPYLHRLGISHVYASPLQKARPGSTHGYDIVDHGAINPELGGEEGFIALSETLH
AHGMKLLLDIVPNHMGVGGSDNPWWLSVLEWGSLSPFADAFDIDWQRLGAGRNLVIPFLG
DRYGEALEKGTLELRFDPDKGAFSVWHYEHQLPIRPLSYPTILNRVIAAIGAVDDDTTAE
LLAISERLRAMAIDTDETRRKTFPEEAEGLKRRLAEIYGVSPLIQEATASTLALLNGFKG
RPDSFGPLHRLLEAQAYRLAHWRVASSDINYRRFFDVNSLAGLRVELSDIFHRSHETVFR
HVREGRIDGLRIDHIDGLADPLGYARALQAAVGPGFYVVVEKILEPGERLRPWPVAGTTG
YDVLNQLDGILVDKGKRAKIERLYTWATGFDEPYGFQLRAAKAEILEISFASELEVLTTD
LKEVADADRRTRDFTVNALRRALIEIIARFPTYRSYLPPDLEEGEVEPEDVRLIEGAVAK
AKRWSSLPDRSVHDFAAEVLLGRIETAGPGRPDPRVVLRFRRRFQQLTGPVMAKSLEDTL
FYRYACLLGLNEVGGDPGEYGIDAEHFHDLQVARARDWPNAMITTATHDTKRGEDARTRL
LALSEIPEEWAKAWDLWQRVAGPHLARIDGEPAPDANDQWMFLQAILGAWPLELLERDEA
GAIEDFRNRLIAYGEKAMREGKRRSSWVNVDAVYEGAVKKLFTALIAPGSDFLRELRPFA
RRLAHLGMLASLGRTVLKCTLPGLPDTYQGTEIWDFSFVDPDNRRPVDYPALERMLEEGG
APAELLGHWPDGRVKQATLTRLLAERAERPDFYASAAYEPVAATGARADHVIAYRRTDPV
QEGGDLFVAVPRLVAGSVGEAVWSGEAFAGTRVDLGAGSRWRDLASGRVVEGEGADLGIL
LRDLPYAVLRREP
NT seq 4902 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccctggaacagctggccgacctcgtcggcgtcgccgccggctacaccgacgcc
ttcggcaagcccgtcgagacgccgctcgaggtgcgccgcggcctgctcgccgcgctgggc
ttcgcggtggaggacgaggccgcgatcgccgggagcctggccgaggtcgagcgcctgcgc
cgcggcctgatcccgccgctcctgcccgtggaggcccgccgggccgcccgcgtcccggtg
cggccgcagaacggcgcgccgcacacgctggtctggcgtctcgtggacgagcgcggcacc
gcccgcgagggacgcgccaacccgcaggggtcggagccgagcttcgagctgccgccgctg
acgccgggctaccaccgcctcatcgtgcaggccgggccgacccgcaccgaatcctgggtg
atcgccgcaccccagcgctgctggcgcccgcgcccctacacggaggagggggcctccgac
tggggtctggccgcccagctctacggcctgcgctcggcgaccaatatcggcatcggcacc
tacgcggatgccggcgaggccgcccgcgaggccgccctgcgcggggcggccttcctgggc
ttgagcccggtccacgccctgttcggctccgaccggaccaagatctcgccctactcgccc
tcctcgcgcctgttcctggagacgctgttcatcgccccgcgcagcctgccgggcctcgcc
gggtcccgggccgaggcgctgctcgccgagcgcgcggacgcgatcacggccttgcgcgag
gcggccctcgtcgaccaccagggcgtccacgacgtgctcgacccggtgctccgggcgctc
tgggccgagtcgccggcccgcgccggcaccgatgcgggcttcgagcagttccgccaggag
ggcggcgaggatctcgaatcgcacgccctgttcgaggcgctgtccgagcatttccggcag
cggggcgcccactggctgggcgactggccggaggattatcgccgggccggcacggacgcg
gtgcgggccttcgcggcggagaacgcggacctcgtcggctaccacgcgtggctgcagtac
ctcgccgaccggcagctcgccgaggcctccgcggcggcgctcggcgccggcatgcgggtc
gggctctaccgcgacctcgcggtcggcgccgaccggggcggctccgagatctggtcgcat
cccgagcgcttcgccgacagggtctcgatcggcgcgccgccggacctgttggcgccgaag
ggccagaactggggcctgccagccttcgacccgctggcgatggagcgcgacgggctcgcg
gccttccgggccctggtgcaggccaacatgcgccacgccggcgcgatccgaatcgaccac
gccttccagctcgcccggctgttcctgatcccgctgggcgccggcgcccaggccggcgcc
tacgtggcgatgccgttcgagccgatgctggcggtgctgcggctggagagccaccgcaac
aagtgcctcgtcatcgcggaggatctcggaaccgccccggagggcttctccgacgcgctg
atgcgggccggggtgctcagctaccggatcctcgccttcgagcgcgagggcgacggacgg
ttcaagccgcccgcggcctacccgcgcgacgcgctcaccgccatcaccacccacgacctg
ccgaccttcgtcggttggtggcgcggggtcgacaccgacacccgccagtcgctgggtctc
tacgaccaggagcgggccgaggccgagcggggcgagcgggtggtggagcgccgccgcctc
gccgaggcgctggcggccgagcagctcatcccctccgccgagcccccggacgccgcgccc
ttcgaggccgccgcccgctatctcgcccgggcccccgcgatgctcacggccgtccagtac
gaggacgtggtctcggaactcgcccaggccaacgtcccgggctcgaccgagggctacccg
aactggcggcgcaagctcgaccgggacctggccgacatcgccgcccccggcgggccgctg
gcgaagctcgcggccgccctctcggccgaggcacggggcccgcgctcgggcgccgcgcgg
ctcgccgcgccgccgccgcgcgcgacctaccggctgcagttccacaaggacttcaccttc
gcggatgcggggaagatcatcccgtacctgcaccggctcgggatcagccacgtctacgcc
tcgccgctccagaaggcgcggcccggctcgacccacggctacgacatcgtcgaccacggc
gcgatcaacccggaactcggcggcgaggagggcttcatcgcgctctccgagacgctccac
gcccacgggatgaagctgctgctcgacatcgtcccgaaccacatgggcgtcggcgggtcc
gacaatccgtggtggctgtcggtgctcgagtggggctccctgtcgcccttcgccgacgcc
ttcgacatcgactggcagcggctcggcgccgggcgcaacctcgtgatcccgttcctcggc
gaccgctacggcgaggccctggagaagggcacgctggagctgaggttcgaccccgacaag
ggcgccttcagcgtctggcactacgagcaccagctgccgatccgccccttgagctacccg
accatcctcaaccgggtgatcgccgccatcggggccgtggacgacgacaccaccgcggag
ctgctcgccatctccgagcggctgcgggccatggcgatcgacaccgacgagacccgccgc
aagaccttccccgaggaggccgaggggctgaagcgccggctcgccgagatctacggcgtg
tcgccgctgatccaggaggccaccgccagcaccctggcgctgctcaacggcttcaagggc
cgcccggacagcttcgggccgctgcaccggctcttggaggcccaggcctaccggctcgcc
cactggcgggtggcctcgagcgacatcaactaccgccgcttcttcgacgtgaactcgctc
gccggcctgcgggtcgagctgtccgacatcttccaccgctcccacgagaccgtgttccgg
cacgtccgcgagggccggatcgacgggctgcgcatcgaccacatcgacggcctcgccgac
ccgctgggctacgcgcgggcgctgcaggcggcggtcggccccggcttctacgtggtggtg
gagaagatcctggagccgggggagcggctgcggccctggccggtggccgggaccacgggc
tacgacgtgctcaaccagctcgacgggatcctggtcgacaagggaaagcgcgcgaagatc
gagcggctctacacctgggccacgggcttcgacgagccctacggcttccagctccgcgcc
gccaaggccgagatcctcgagatcagcttcgccagcgagctggaggtgctgaccaccgac
ctcaaggaggtcgccgacgccgaccggcgcacccgcgacttcaccgtcaacgccctgcgc
cgggcgctgatcgagatcatcgcgcgcttcccgacctaccggagctacctgccgccggat
ctggaggagggcgaggtcgagcccgaggacgtgcgcctgatcgagggcgccgtcgcgaag
gccaagcgctggtcgagcctgcccgaccgctcggtccacgatttcgccgccgaggtcctg
ctcgggcggatcgagacggcgggacccggccggccggacccgcgggtggtgctgcgcttc
cgccgccggttccagcagctcaccggcccggtcatggccaagagcctggaggacacgctg
ttctaccggtacgcctgtctgctcggcctcaacgaggtcggcggcgatccgggcgagtac
gggatcgacgcggagcatttccacgatctgcaggtcgcccgcgcccgggactggccgaac
gccatgatcaccacggcgacccacgacaccaagcgcggcgaggatgcccgcacccggctg
ctcgccctttcggagatccccgaggaatgggccaaggcctgggacctgtggcagcgggtc
gccggcccgcacctcgcccggatcgacggcgagccggcccccgacgccaacgaccagtgg
atgttccttcaagccatcctcggcgcctggcccctggagctgctggagcgggacgaggca
ggcgcgatcgaggatttccgcaatcggctgatcgcctacggcgagaaggccatgcgcgag
ggcaagcgccggtcgagctgggtcaacgtcgacgcggtctacgagggcgcggtcaagaag
ctgttcacggcgctgatcgcccccggctcggatttcctccgggaactccggcccttcgcc
cggcggctcgcccatctcggcatgctggcgagcctcggccggacggtcctgaaatgcacc
ctgccgggcctgcccgacacctaccagggcacggagatctgggacttctccttcgtcgat
cccgacaaccgccgcccggtggactacccggccctggagcggatgctggaagagggtggg
gcgcccgccgagctgctgggccactggccggacgggcgggtcaagcaggcgacgctgacg
cggctgctcgccgagcgggccgagcgcccggacttctacgcgagcgccgcctacgagccc
gtcgcggcgaccggcgcacgggccgaccacgtcatcgcctaccggcggaccgatcccgtc
caggaaggcggcgacctgttcgtggcggtgccgcggctggtggcgggctccgtcggggag
gccgtctggtcgggcgaggccttcgcgggcacccgggtcgatctcggggccggcagccgc
tggcgggacctcgcctcgggacgggtggtcgagggggagggggccgatctcgggatcctc
ctgcgcgacctgccctacgcggtgctgcggcgggaaccgtga

DBGET integrated database retrieval system