KEGG   Methylobacterium radiotolerans: Mrad2831_1643Help
Entry
Mrad2831_1643     CDS       T00674                                 

Definition
(GenBank) Nicotinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00760  Nicotinate and nicotinamide metabolism
mrd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Mrad2831_1643
Enzymes [BR:mrd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Mrad2831_1643
    3.5.1.-  
     Mrad2831_1643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-ProteinID: ACB23638
JGI: Mrad28311643
UniProt: B1M6H8
Position
complement(1752385..1753011)
Genome map
AA seq 208 aa AA seqDB search
MTPGSADLLLVVDVQVDFLPGGALPVPEGDAVVGPINDLQHRFRHVVLMQDWHPADHVSF
AETHPGRAPFETVARPYGPQVLWPRHCVQGSPGAAFAPGLATDRASLVVRKGLDPRVDSY
SAFLEADRSTRTGLAGALRERGITRVAVCGLATDFCVAWSALDASDAGFEVLVVEDAVRG
IDVDGSLAQAWARMEAAGVRRIRSAQIG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccggcagcgccgacctgctcctcgtcgtcgacgtgcaggtcgatttcctgccg
ggcggggcgctcccggtcccggaaggcgacgcggtggtcggcccgatcaacgacctccag
caccgcttccggcacgtggtgctgatgcaggactggcatccggccgatcacgtctccttc
gccgagacccatccggggcgggccccgttcgagaccgtggcgcggccctacgggccgcag
gtgctgtggccgcgccactgcgtccagggcagcccgggcgccgccttcgcgccgggtctc
gccaccgaccgggcgagcctcgtggtgcgcaaggggctcgatccccgggtcgacagctac
tcggccttcctggaggccgaccggtcgacccgcaccgggctcgccggggcgctcagggag
cgcggcatcacccgcgtcgccgtgtgcggcctcgccaccgatttctgcgtcgcctggagc
gcgctcgacgccagcgacgcgggtttcgaggtcctcgtggtggaggatgcggtgcgcggg
atcgacgtggacgggtcgctcgcgcaggcctgggcgcgcatggaggcggcgggggtgcgc
cggatccggtcggcgcagatcggctga

DBGET integrated database retrieval system