KEGG   Methylobacterium radiotolerans: Mrad2831_1717Help
Entry
Mrad2831_1717     CDS       T00674                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mrad2831_1717
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mrad2831_1717
   00630 Glyoxylate and dicarboxylate metabolism
    Mrad2831_1717
Enzymes [BR:mrd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mrad2831_1717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1825170..1827332)
Genome map
AA seq 720 aa AA seqDB search
MSNLVVAEDLRTFLSEEALPGTGLSADQFWSGFAAIVRDLAPHNRALLDRRDGLQADIDS
WHRDHRGEPHDPVAYAAYLTRIGYLQPEPAAVRVTTENVDAEIAAIAGPQLVVPISNARY
ALNAANARWGSLYDALYGTDAIPQDGDRAPGTGFNPARGAAVVARTKAFLDAIAPLSVGS
WADAVGFSVTDGRLAIDLGAGRSAGLTGSATFAGFTGDAAAPTALLLRHNGLHIEIVIDR
ASPIGRTDPAGIADVVLEAALSTIMDMEDSVAAVDSADKVAVYRSWLGLMRGDLVATLSK
GGRTIERRLAADRTFTAPDGGRLTLPGRSLMLVRHVGHHMYTDAVTLDGAEIPETILDAA
VTALIALHDLKGTGPLRNSRTGSVYMVKPKLHGPDEVAFAVELFGRVEALVGLAPRTLKI
GVMDEERRTTLNLKAAIAAAADRLFFINTGFLDRTGDEIHTSLEAGPVVRKDAMKATAWI
KAYEDGNVDAGLACGLPGHAQIGKGMWAAPDRMAAMLDAKGAHPEAGANTAWVPSPTAAT
LHALHYHQVDVRARQAALAGRAPATRAAMLTLPLAAGALAPEAVREELDNNCQGILGYVV
RWVDQGVGCSKVPDIHEVGLMEDRATLRISSQHIANWLRHGIVDRAQVAAALRRMAETVD
RQNAGDPAYRPMAPGFDGPAFRAAEALVFEGAGQPNGYTEFVLHRFRREAKRLDAPVRAA
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatctcgtcgtcgccgaggatctccgcaccttcctgtccgaggaggcgctgccg
gggaccggcctctcggccgaccagttctggtcgggcttcgccgcgatcgtccgcgatctc
gcaccgcacaacagggcgctgctcgaccggcgggacggcctccaggcggacatcgattcc
tggcaccgcgaccatcgcggcgagccgcacgacccggtggcctacgcggcctacctgacg
cggatcggctacctgcagccggagcccgcggccgtgcgggtgaccaccgagaacgtggac
gcggagatcgccgcgatcgccgggccgcagctcgtggtgccgatctccaacgcccgctac
gcgctcaacgccgccaatgcccgctggggcagcctctacgacgccctctacggcaccgac
gcgatcccgcaggacggcgaccgcgcgcccggcaccgggttcaacccggcccggggcgcc
gcggtggtggcccggaccaaggcgttcctcgacgcgatcgcgccgctcagcgtcggctcc
tgggcggatgccgtgggcttctcggtgacggacggccgcctcgccatcgacctcggcgcc
ggccgcagcgccggcctgaccggctcggccaccttcgcgggcttcaccggcgacgccgcg
gcgccgaccgcgctcctgctgcgccacaacggcctgcatatcgagatcgtcatcgaccgc
gcgagcccgatcggacgcaccgacccggccggcatcgccgacgtggtgctggaggccgcc
ctctcgaccatcatggacatggaggattcggtggcggccgtggactcggccgacaaggtc
gcggtctaccggagctggctcggcctgatgcgcggcgacctcgtcgccaccctgtccaag
ggcggccgcacgatcgagcggcggctcgccgcggaccggaccttcacggcccccgacggc
gggcgcctgaccctgccgggccggtcgctgatgctggtccggcatgtcggccaccacatg
tacaccgacgcggtgaccctcgacggcgccgaaattcccgagacgatcctcgacgcggcg
gtcaccgcgctgatcgccctgcacgacctgaagggcaccggtccgctccgcaacagccgg
accggctcggtctacatggtcaagcccaagctgcacggccccgacgaggtcgccttcgcg
gtcgagctgttcggccgggtcgaggcactggtcggactcgcgccgcggacgctcaagatc
ggcgtcatggacgaggagcggcgcacgacgctgaacctcaaggcggcgatcgcggcggcg
gcggaccggctgttcttcatcaacacgggcttcctcgaccggaccggcgacgagatccac
acctcgctggaggccggccccgtggtccgcaaggacgccatgaaggcgaccgcctggatc
aaggcctacgaggacggcaacgtcgatgccggcctcgcctgcggcctgccgggccacgcc
cagatcggcaagggcatgtgggccgcccccgaccggatggccgcgatgctcgacgccaag
ggcgcccacccggaggcgggcgccaacaccgcctgggtgccgtcgccgacggccgcgacg
ctccacgcgctccactaccatcaggtggatgtccgcgcccgccaggcggcgctcgccggc
cgggcgcccgcgacccgcgccgccatgctgaccctgccgctcgccgcgggcgcgctcgcg
ccggaggcggtgcgggaggagctcgacaacaactgccagggaatcctgggctacgtggtc
cgctgggtcgaccagggcgtcggctgctccaaggtgccggacatccacgaggtcgggctg
atggaggaccgcgccaccctgcggatctccagccagcacatcgccaactggctgcgccac
gggatcgtggatcgcgcgcaggtcgccgccgccctgcggcggatggccgaaaccgtcgat
cgccagaacgccggcgacccggcctaccggccgatggccccgggcttcgacgggccggcc
ttccgcgccgccgaggccctggtcttcgagggcgccggccagccgaacggctacaccgag
ttcgtgctgcaccggttccgccgggaggcgaagcgcctggacgcccccgttcgggcggcc
tga

DBGET integrated database retrieval system