KEGG   Methylobacterium radiotolerans: Mrad2831_1835Help
Entry
Mrad2831_1835     CDS       T00674                                 

Definition
magnesium chelatase ATPase I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mrd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1961631..1962641)
Genome map
AA seq 336 aa AA seqDB search
MPTFPFSAIVGQDEMRQALLIAAVDPAVGGVLVFGDRGTGKSTAIRALAALLPPMRAVVG
CPYNCDPDSPAESCPHCAEGGPRKSHKKPVPVVDLPLGATEDRVVGTLDLERALGAGVKA
FEPGLLARANRGFLYIDEVNLLEDHLVDLLLDVAASGVNTVEREGLSLRHPARFVLVGSG
NPEEGELRPQLLDRFGLACEVATPKDIPTRIAVVRARDAYERDPEGFCAAHACGERKIQK
SILLARERLPAVTVPDAALERAARLCLALGTDGLRGELTLMRTARALAALDGAGAVTDDH
LRRIAPAALRHRLRRNPLDESGSTARVERALAEVFA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgcccacctttcccttctcggccatcgtcggccaggacgagatgcgccaggcgctgctg
atcgcggcggtggacccggcggtcggcggcgtgctggtcttcggcgaccgcggcacgggc
aagtccacggcgatccgggcgctggccgccctgctgccgccgatgcgggcggtggtcggc
tgcccgtacaattgcgatcccgacagcccggcggagagctgcccgcactgcgccgagggt
ggcccgcgcaagagtcacaagaagccggtgcccgtcgtggacctgcccctcggcgccacc
gaggaccgggtggtcggcaccctcgacctggagcgggcgctcggcgccggcgtgaaggcg
ttcgagccggggctgctggcgcgcgccaatcgcgggttcctgtacatcgacgaagtgaac
ctcctcgaggaccacctcgtggacctgctgctcgacgtggcggcctccggcgtcaacacc
gtggagcgcgagggcctgtcgctccgccacccggcgcggttcgtcctcgtcgggtccggc
aacccggaggagggggagttgcgcccgcagctcctcgaccggttcgggctggcctgcgag
gtcgcgaccccgaaggacatcccgacccgcatcgcggttgtgcgcgcccgcgacgcctac
gagcgcgacccggagggtttctgcgcggcgcacgcgtgtggcgagcgcaagatccagaag
agcatcctgctggcgcgggagcgcctgcccgcggtgactgtcccggacgccgccctggag
cgcgcggcgcggctctgcctggcgctgggcaccgacgggctgcgcggcgagctgaccctg
atgcgcaccgcgcgggcgctggccgccctcgacggcgccggggcggtgaccgacgaccac
ctccggcgcatcgccccggccgccctgcgccaccggctgcgccgcaacccgctggacgaa
tccggttccaccgcccgggtggagcgggcgctggcggaggtgttcgcgtga

DBGET integrated database retrieval system