KEGG   Methylobacterium radiotolerans: Mrad2831_1872Help
Entry
Mrad2831_1872     CDS       T00674                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mrad2831_1872
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mrad2831_1872
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mrad2831_1872
Enzymes [BR:mrd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mrad2831_1872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2000181..2001422)
Genome map
AA seq 413 aa AA seqDB search
MTIAPEPNSFRTGPDERGRFGIFGGRFVAETLMPLILELEAAYETAKKDPAFQAEMESYG
THYIGRPSPLYYAERLTEHLRAKAPAGQGAKVYFKREELNHTGSHKVNNVLGQILLARRM
GKPRIIAETGAGQHGVATATLCARFGLKCVVYMGAVDVARQAPNVFRMKMLGAEVVPVES
GTKTLKDAMNEALRDWVTNVADTFYCIGTVAGPHPYPAMVRDFQSVIGRETREQMIAQEG
RIPDSLVACIGGGSNAMGLFHPFLDDREVEIFGVEAAGHGVQSGLHAASLTGGKPGVLHG
NRTYLLMDGDGQIADAHSISAGLDYPGIGPEHAWLHEMGRVTYLSATDSETLEAFKLCSM
LEGIIPALEPAHALSKVLELAPQRPAEHLMVMNMSGRGDKDIPQVAEIFGTKI
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcgcgcccgagcccaactccttccgcaccggccccgacgagcgcggccgcttt
ggcatcttcggcggccgcttcgtcgccgagacgctgatgccgctgatcctcgagctcgag
gcggcctacgagacggccaagaaggatccggccttccaggccgagatggagagctacggc
acgcactatatcggccggccgagcccgctctactacgccgagcgcctgaccgagcacctg
cgcgccaaggcgccggcggggcagggcgccaaggtctatttcaagcgcgaggagctgaac
cataccggctcccacaaggtgaacaacgtgctgggccagatcctgctggcccgccgcatg
ggcaagccgcggatcatcgccgagaccggcgccggccagcacggcgtcgccaccgcgacg
ctctgcgcgcgcttcggcctcaagtgcgtcgtctacatgggcgcggtcgacgtcgcccgg
caggcgcccaacgtcttccgcatgaagatgctcggcgccgaggtggtcccggtggaatcc
ggcaccaagaccctcaaggacgccatgaacgaggcgctgcgcgactgggtcaccaacgtc
gccgacacgttctactgcatcggcacggtggcgggcccgcacccgtacccggcgatggtg
cgcgacttccagtcggtgatcggccgcgagacccgcgagcagatgatcgcgcaggagggc
cggatcccggactccctcgtcgcctgcatcggcggcggctcgaacgccatgggcctgttc
cacccgttcctcgacgaccgcgaggtcgagatcttcggcgtcgaggccgcgggccacggc
gtccagtcgggcctgcacgcggcctcgctgaccggcggcaagccgggcgtgctgcacggc
aaccgcacctacctgctgatggacggggacggccagatcgccgacgcccactcgatctcg
gccggcctcgactacccgggcatcggccccgagcacgcgtggctgcacgagatgggccgg
gtcacctacctgtcggcgaccgattccgagacgctggaggcgttcaagctctgctcgatg
ctggaggggatcatccccgccctggagccggcccacgccctgtccaaggtcctggagctc
gcgccccagcgcccggccgagcacctcatggtgatgaacatgtcgggccgcggcgacaag
gacatcccgcaggtggccgagatcttcggcacgaagatctga

DBGET integrated database retrieval system