KEGG   Methylobacterium radiotolerans: Mrad2831_2070Help
Entry
Mrad2831_2070     CDS       T00674                                 

Definition
(GenBank) uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00860  Porphyrin and chlorophyll metabolism
mrd01100  Metabolic pathways
mrd01110  Biosynthesis of secondary metabolites
mrd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mrad2831_2070
Enzymes [BR:mrd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mrad2831_2070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACB24065
JGI: Mrad28312070
UniProt: B1LVI4
Position
2200450..2201169
Genome map
AA seq 239 aa AA seqDB search
MRIWVARPEPGATRTGAALAVLGHAPLVAPVLAVRPTAAALPVGPFAALLLTSANAVSAL
RPALRDAPALRGLPVFAVGARTAALAREAGLGPVREGPGDAAGLAALVAASLPPGEPLLH
ATGAERKPEPAAALTAAGFRITAFVAYRAEALERLPPAVGRDLAEHRLEAALHYSRRSAA
VALALADGSEHGGAFRRLRHYCLSPDVAAPLEAAGVPVHFVAARPREADLLDALARRPG
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
ttgcggatctgggtggcgcggcccgagccgggggcgacgcggaccggagcggccctcgcg
gtcctgggccacgcgccgctcgtggcccccgtcctggctgtgcggccgaccgcggcggcg
ctgcccgtgggacccttcgccgcgctgctcctcaccagcgccaacgcggtgtcggcgctc
cggccggcgctccgggacgcgccggccctgcgcggccttcccgtcttcgccgtcggcgcg
cggacggccgccctggcccgcgaggccggtctcggccccgtgcgggaggggcccggcgac
gccgcggggctcgccgccctggtggcggcgtcgctgccgcccggcgaaccgctcctccac
gcgaccggggccgagcgcaaaccggagccggcggcggcgctgacggcggccggatttcgg
atcaccgccttcgtggcttaccgggccgaggcgctggagcgcttgccgccggcggtcggc
cgcgacctcgccgaacaccgcctcgaggcggcccttcactattcccggcgcagcgccgcc
gtcgcccttgccctcgcggatggttcggagcacggcggagctttccgccggctgaggcat
tactgcctatcgccggatgtcgcggcacccctggaagcggccggtgttccggtccatttc
gtcgcggcacgcccgcgcgaagcggacctgctcgacgccctggcacggcgaccgggctaa

DBGET integrated database retrieval system