KEGG   Methylobacterium radiotolerans: Mrad2831_2106Help
Entry
Mrad2831_2106     CDS       T00674                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mrd  Methylobacterium radiotolerans
Brite
Enzymes [BR:mrd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Mrad2831_2106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2236517..2237566
Genome map
AA seq 349 aa AA seqDB search
MARFRPGRGRVAVAALLASALAILAAAAHEGPHEGPHEGPADAELSAEAADALGVITPVP
GTLGADPDRAAIGRLLFTDTRLSRGGDRACITCHDIRTSGASAVPRNLTADGTPVPRNTP
TAFNAALSFRLGWAGDIPSLREQAELALTRPEFLGGSWPRILDTVRDDPVLAPMFQAAYG
RGADREAVIDAINSFERTLLTPDSRFDRWLRGDARAITGPERAGYDLFRRIGCAACHQGV
NVGGNLFEKVGIFVTIPNKVAEVLRVPSLRNVAVTAPYFDDGGVATLPEAVRLMARAQLG
RELTPAQVDGIVAFLGTLTGTYEGRPLTAPLAPGAGLQDGARPDGKPQL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtggcccggttccgtcccggccgcggccgcgtcgcggtcgccgcgctcctcgccagcgcg
ctggcgatcctcgcggcggccgcccacgaggggccgcacgaggggccgcacgaggggccg
gccgacgccgaactctccgccgaggccgcggatgccctgggggtgatcacgccggtgccg
ggcaccctgggggcggacccggaccgggccgccatcggccggctgctcttcaccgacacg
cggctgtcgcgcggaggcgaccgggcctgcatcacctgtcacgacatccgcaccagcggc
gcgagcgcggtgccccggaacctgaccgccgacggcacgccggttccgcgcaacacgccg
acggccttcaacgcggcgctcagcttccggctgggctgggccggcgacatcccgagcctg
cgcgagcaggccgagctcgccctgacgcggcccgaattcctgggcggctcctggccgcgg
atcctcgacacggtccgcgacgacccggtgctcgccccgatgttccaggccgcctacggc
cgcggggccgaccgggaggcggtgatcgacgcgatcaacagcttcgagcgcaccctgctc
accccggacagccgcttcgaccgctggctgcgcggcgacgcccgcgccatcaccggcccg
gagcgggcgggctacgacctgttccgacggatcggctgcgcggcgtgccaccagggcgtc
aatgtcggcggcaacctgttcgagaaggtcgggatcttcgtcacgatccccaacaaggtc
gccgaggtgctgcgggtgccgagcctgcgcaacgtcgcggtcaccgcgccctacttcgac
gatggcggcgtcgccacgctccccgaggcggtccggctcatggcgcgggcgcagctcggc
cgggaactcaccccggcgcaggtcgacgggatcgtcgccttcctgggaaccctgaccggc
acctacgagggccggcccctgaccgcgccgctggcgcccggcgcggggttgcaggacggc
gcgcgcccggacggcaagccgcagctatga

DBGET integrated database retrieval system