KEGG   Methylobacterium radiotolerans: Mrad2831_2380Help
Entry
Mrad2831_2380     CDS       T00674                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00521  Streptomycin biosynthesis
mrd00523  Polyketide sugar unit biosynthesis
mrd01130  Biosynthesis of antibiotics
Module
mrd_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Mrad2831_2380
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mrad2831_2380
Enzymes [BR:mrd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Mrad2831_2380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACB24375
JGI: Mrad28312380
UniProt: B1LYV4
Position
complement(2522729..2523280)
Genome map
AA seq 183 aa AA seqDB search
MDVIETEIPDVKRIVLKRFGDARGWFSETFRADTLARAGIATPFIQDNQSFSAPQGTVRG
LHFQIAPRAQAKLIRVLQGAILDVAVDIRSDSPTYGKYVAVTLDAEKGEQLYIPHGFAHG
FCTLTPDVMVTYKVDDYYSPEHDRALFWNDPAIGIPWPVSGEAAILSDKDRRAPKLADLG
SVF
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcatcgagaccgagatccccgacgtgaagcgcatcgtcctgaagcgcttcggc
gacgcgcggggctggttctcggagaccttccgggccgacaccctggcgcgggccgggatc
gccacgccgttcatccaggacaaccagtccttctcggccccgcaggggacggtccgcggc
ctccacttccagatcgccccccgcgcgcaggccaagctgatccgcgtgctgcagggcgcg
atcctcgacgtggcggtcgatatccgcagcgactcgccgacctacgggaagtacgtcgcc
gtcaccctcgacgccgagaagggcgagcagctctacatcccgcacggcttcgcgcacggc
ttctgcaccctgacccccgacgtgatggtcacctacaaggtcgacgactactacagcccc
gagcacgaccgcgcgctgttctggaacgatccggcgatcgggatcccgtggccggtctcg
ggagaggcggcgatcctgtccgacaaggatcgccgggcgcccaagctcgccgatctcggc
agcgtcttctga

DBGET integrated database retrieval system