KEGG   Methylobacterium radiotolerans: Mrad2831_2611Help
Entry
Mrad2831_2611     CDS       T00674                                 

Definition
putative phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mrd00030]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:mrd00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2769888..2772470)
Genome map
AA seq 860 aa AA seqDB search
MVGVRFSSYREADLDATHGAKERHQGGHRDEAQGLAFVPGPLGPGNLRRIDAYWRAANYL
SVGQIYLMANPLLREPLKPEHVKPRLLGHWGTTPGLNFIYAHLNRAIRQRDLDMIAVWGP
GHGAPGLVANAYLEGTYSEIYPNVAQDLDGMARLFRQFSFPGGIPSHASPELPGSIHEGG
ELGYSLAHAFGAALDNPGLIVACVVGDGEAETGPLAASWHSNKFLNPTTDGAVLPILHLN
GYKIANPTLLARMPTDELRSLLVGYGYEPSFVEGDEPAAMHQAMATALDAVLDEIAAIRH
SARCGELRRPRWPMIVLRSPKGWTGPKDVDGKPVEGTWRSHQVPVAATRENPEHRAILEA
WMRSYRPEELFAEGGSLVPELAALAPKGPRRLSANPHANAHGTRPLRLPDLRQLAVAVSE
PGRSQGEATRALGRYLREVLTLNADSRNFRLMGPDETASNRLDAAFEVTGRAWQEEILPG
DDHLARDGLVMEVLSEHLCEGWLEGYVLTGRHGLFATYEAFAHVVDSMVNQHAKWLKSSR
DLPWRRPVPSLNILLSSHVWRQDHNGFSHQDPGFIDFVANKRGDTARIYLPPDANCLLCV
TDHCLRTYDRINVVVAGKQPAPQWLSLDEAVTHCAAGVGVWEWASNEGEAEPDVVMACAG
DVPTQETLAAVDWLRRHVPEMRVRVVNVVDLMTLPAPETHPHGLDDPTFDSLFTRDRPVV
FAYHGYPWLIHRLTYKRTNHGNFHVHGFIEEGTTTTPFDMCVLNRLDRFHLAQAAIRAVP
RLGARAEHAEEALRDALAAHREHVRRTGDDLPEVRDWTWSGRHAPGDHDRRIEGDIMQCG
PTDADGPGRSGTVDGCTVVT
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggtcggcgtcaggtttagcagctaccgggaggccgacttggacgcgacgcacggggca
aaggagcgccaccaaggcggccatcgggacgaggcacaaggcctggcattcgtgcccggg
ccgctcggacccgggaaccttcggcggatcgatgcctactggcgagcggccaactacctg
tcggtcgggcagatctacctcatggccaacccgcttctgcgcgagccgctgaagcccgag
cacgtcaagccgcggctcctcgggcactggggcacgacacccggcctcaacttcatctac
gcgcacctgaaccgggccatccgccaacgtgacctcgacatgatcgcggtctgggggccg
ggtcacggcgcgcccgggctcgtcgccaacgcctacctggagggcacctatagcgagatc
tacccgaacgtggcgcaggacctcgacgggatggcccggctgttccggcagttctccttt
cccgggggcatcccgagccacgcctcgccggaactgccgggctccatccacgagggcggc
gagctcggctattccctggcccatgctttcggcgccgccctggacaaccccggcctgatc
gtcgcttgcgtggtcggcgacggcgaggcggagaccgggccgctcgccgcgtcatggcac
tccaacaagttcctgaacccgacgaccgacggcgccgtcctgccgatcctgcacctaaac
ggctataagatcgccaacccgacgctcctcgcccggatgcccacggacgagcttcgcagc
ctcctcgtcgggtacggctacgagccgtccttcgtcgagggcgacgaaccggccgccatg
caccaagccatggcgacggccctcgacgcggtcctcgacgagatcgcagccatccggcac
tccgcgcgctgcggcgagctccgtcgaccgcgctggccgatgatcgtgctgcgcagcccc
aagggctggacgggaccgaaggacgttgacggcaagccggtcgagggaacctggcgttcg
catcaggttcctgtcgcggccacgcgggaaaacccggagcaccgcgcgatcctggaagcc
tggatgcgctcctacaggccggaggagctgttcgcggaaggcggctcgctcgtccccgag
ctcgccgcgctggctcccaagggaccgcggcgcctctcagccaatccgcatgccaacgct
catgggacacgccccctccgcctgccggatctgcggcagctggctgtcgcggtctcggaa
ccgggacgttcccagggcgaagctacccgcgcgctcggaaggtacctgcgcgaggtcctg
accctgaacgcggacagccgaaactttcgcctcatggggcccgacgagaccgcctcgaac
cggctggacgcggcgttcgaggtgacgggccgcgcctggcaggaagagatcctgccgggc
gatgaccacctcgcccgagacgggctggtcatggaggtgctgagcgagcatctctgcgag
ggctggctcgaaggttacgtgctcaccggccgccatggactgttcgcgacctacgaggcc
ttcgcgcacgtggttgactcgatggtgaaccagcacgccaagtggctgaagtcctcccgc
gacttgccctggcgccggccggtgccgtccctcaacatcctgctctcgtcgcatgtctgg
cggcaggaccacaacggcttcagccaccaagacccgggcttcatcgacttcgtggcgaac
aagcgcggggacacggcgcggatttacctgccgccggacgcgaactgcctgctctgcgtc
accgaccactgcctgcgcacctacgaccgcatcaacgtcgtcgtggccggcaagcagccc
gcgccgcagtggctcagcctggacgaggcagtcacgcactgcgctgccggcgtcggagtc
tgggagtgggcctcgaacgagggggaagcggagcccgacgtcgtgatggcctgcgcgggc
gacgtgccgacgcaggagacgctcgccgccgtggactggctgcgccggcacgtcccggag
atgcgggtccgggtggtgaacgtcgtcgacctgatgacgctgccggcgcccgagacgcac
ccgcacgggctcgatgacccgacgttcgacagcctcttcacgcgcgaccggccggtagtg
ttcgcctaccacggctatccatggctgatccacaggctgacctacaagcggaccaaccac
gggaacttccacgtgcacgggttcatcgaggagggcacgacgacgacgcccttcgatatg
tgcgtgctgaaccggctcgaccggttccacctcgcgcaggccgcgatccgggccgtcccg
cgactgggcgcccgggcagagcacgccgaggaggcgctccgggatgcgctggccgcccat
cgcgagcacgtccgccggaccggcgacgacctgccggaggtacgggattggacctggtcg
ggacggcacgcccccggggaccacgaccgccggatcgagggcgacatcatgcagtgcggc
ccgaccgacgcggacgggcccggccggtcggggaccgtggacggttgtacggttgtcacc
tga

DBGET integrated database retrieval system