KEGG   Methylobacterium radiotolerans: Mrad2831_2614Help
Entry
Mrad2831_2614     CDS       T00674                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mrad2831_2614
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mrad2831_2614
  Lipid metabolism
   00071 Fatty acid degradation
    Mrad2831_2614
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mrad2831_2614
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mrad2831_2614
   00626 Naphthalene degradation
    Mrad2831_2614
Enzymes [BR:mrd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mrad2831_2614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2773451..2774434
Genome map
AA seq 327 aa AA seqDB search
MLAMVLREVGGPLVPEQRPDPEPGHGEVRIRVEACAVCRTDLHVIDGELPQAVYPIVPGH
EVVGIVDAVGPGVNEPRSGTRVGVPWLGHACGHCHYCEAGRENLCDEPGFTGCTRDGGFA
GHLVAEAAFTIPLGMSLDPVATAPLLCAGLIGWRTLRMAGAAETVGLYGFGAAAHIVAQV
CRWQGRRVFALTRPGDREAQDFARSLGVAWAGGSDEPPPEPLDAALVFAPDGSLVPLALK
AVRKGGRVVCGGIHMSDIPAFPYDLLWGERAVLSVANLTREDARSFIEVVPQAGIVTHTS
TYPLAQANGAIAAHRSGVLQGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgatggtgctgcgcgaggttgggggcccgctcgtgcccgagcagcggcccgac
ccggaacccggtcacggtgaggtccgcatccgggtcgaggcctgcgcggtctgccgaacg
gacctccacgtcatcgacggcgagcttccgcaggcggtgtaccccatcgtgccgggccac
gaggtcgtcggcatcgtcgacgcggtcgggccgggcgtaaacgagccgcgatcgggcacc
cgcgtcggcgtaccctggctcgggcatgcctgcggccactgccactactgcgaggccggc
cgcgaaaacctgtgcgatgagcccggcttcaccggttgcacgcgcgacggcggcttcgcc
ggccatctcgtcgccgaggccgccttcactatcccgctcggcatgagcctggaccccgtc
gcgacggcgccgctcctgtgcgcggggctgatcggctggcgcacgctacggatggccggc
gcggccgagacggtcgggctctacgggttcggggcggccgcccacatcgtcgcccaggtc
tgccgctggcagggccgacgcgtgttcgcgctgacgcgaccgggtgaccgtgaggcgcag
gatttcgcccgctcgctcggggtcgcctgggccggcggctcggacgagccgccgcctgag
ccgctcgacgcggccctcgtctttgcgccggacgggagcctcgtcccgctcgccctcaag
gccgtacgcaagggtggccgcgtggtctgcggcggcatccacatgagcgacatcccggcc
ttcccctacgaccttctctggggcgagcgcgcggtgctctccgtggccaacctgacgcga
gaggacgcgcgcagcttcattgaggtcgtcccgcaggccggcatcgtcacgcacacgagc
acgtaccccctggcgcaagccaacggggccatcgcggcgcaccggtccggggtcctgcag
ggcgcggccgttctcgtgccctga

DBGET integrated database retrieval system