KEGG   Methylobacterium radiotolerans: Mrad2831_2642Help
Entry
Mrad2831_2642     CDS       T00674                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
mrd  Methylobacterium radiotolerans
Brite
Enzymes [BR:mrd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Mrad2831_2642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2794789..2795379
Genome map
AA seq 196 aa AA seqDB search
MLAFFRKLGVAVAVGTASAAPRAVAGNPAPAIAAARTSSKSGVGSRLKRSAAAAALCTGL
VGGFEGLRTTAYPDPATGREPWTACFGETEGIRRGDTFTVAECKAMLARSLEKYALRMEA
CVTRPMADETYAAFLSLSYNVDSGGFCKSSVARLWNAGESRASYDAMLRFNRAAGVTMPV
LTRRRTQERALCLKGI
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgctggccttcttccgcaagctcggcgtcgcggttgccgtcggcacagccagcgccgca
ccccgcgccgttgccggaaatccggcgcccgccatcgccgccgccaggacctcctcgaag
tccggcgtcgggtcccggctgaagcgctccgccgcggcggccgcgctctgcaccggcctc
gtcggcgggttcgagggcctgcgcaccacggcctacccggacccggcgacgggccgggaa
ccctggaccgcgtgcttcggcgagaccgagggcatccgccgcggcgacacgttcacggtc
gccgagtgcaaggcgatgctggcccggagcctggagaagtacgccttgcggatggaggcc
tgcgtcacccgcccgatggcggacgagacctacgccgccttcctgagcctctcctacaac
gtcgactcgggcggcttctgcaagagctcggtcgcccgcctctggaacgccggggagagc
cgcgcctcctatgacgcgatgctccgcttcaaccgcgccgccggcgtcacgatgccggtg
ctgacccggcgccggacgcaggagcgcgccctctgcctaaagggaatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system