KEGG   Methylobacterium radiotolerans: Mrad2831_2765Help
Entry
Mrad2831_2765     CDS       T00674                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00520  Amino sugar and nucleotide sugar metabolism
mrd01100  Metabolic pathways
mrd01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mrad2831_2765
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Mrad2831_2765
Enzymes [BR:mrd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Mrad2831_2765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ACB24749
JGI: Mrad28312765
UniProt: B1M333
Position
complement(2901346..2902350)
Genome map
AA seq 334 aa AA seqDB search
MTSRALILGCSGKSLLAEERAFFRDVKPWGFILFKRNIGTPDEVRALTGALRDCVGSEQA
PVLIDQEGGRVQRMGPPHWPAYPAGGRYGRLNGSAATVARLGARLMAHDLAEVGINVDCA
PVLDVPAPGSHDIIGDRAYGTSPERVAEIGRAVAEGLMAGGVLPVMKHIPGHGRATCDSH
HGLPVVDATRADLAGQDFRTFRALADLPMAMSAHVVFTAIDPDRPATQSATVVRDIIRGA
IGFDGLLMTDDLSMHALTGTFRDRTERAFAAGIDVGLHCNGAMDEMRAVAEAAPELTGAA
ARRAAAALARLDPAGDGLDVAEARDRFAAALAAA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacctcccgcgccctgatcctcggctgctccggtaagtcgctcttggcggaggagagg
gccttcttccgggacgtgaagccctggggcttcatcctgttcaagcgcaacatcgggacg
cccgacgaggtccgcgccctcaccggggcgctccgggactgcgtcggctccgagcaggcg
ccggttttgatcgaccaggaaggcggccgggtccagcgcatggggccgccccactggccg
gcctacccggccggcggccgctacggccgcctgaacggcagcgccgccacggtcgcccgc
ctcggggcgcgcctcatggcgcacgacctcgccgaagtcgggatcaacgtcgactgcgcc
cccgtcctcgacgtgccggcgccgggctcgcacgacatcatcggtgaccgcgcctacggg
acgagcccggagcgggtggccgagatcgggcgcgccgtggccgagggcctgatggccggc
ggcgtcctgccggtgatgaagcacattcccgggcacgggcgcgccacctgcgacagccac
cacggcctcccggtggtcgacgcgacccgcgcggatctcgcgggtcaggatttccggacc
ttccgggcgctcgccgacctgccgatggcgatgagcgcgcacgtcgtcttcaccgccatc
gaccccgaccggccggccacccagtcggcgaccgtcgtccgcgacatcatccgcggcgcc
atcggcttcgacggcctgctgatgaccgacgacctgtccatgcacgcgctgaccggcacg
ttccgcgaccggacggagcgcgccttcgcggcggggatcgatgtcgggctccactgcaac
ggcgcgatggacgagatgcgggccgtggccgaggcggcgcccgaactcaccggcgcggcc
gcccgccgcgccgccgccgcgctggcgcggctcgaccccgctggcgacgggctggacgtc
gcggaggcccgggaccgcttcgccgcggccctcgcggccgcctga

DBGET integrated database retrieval system