KEGG   Methylobacterium radiotolerans: Mrad2831_2791Help
Entry
Mrad2831_2791     CDS       T00674                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mrd00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2930592..2931263)
Genome map
AA seq 223 aa AA seqDB search
MDRDERIARESVVAAARALDAQGLNRGTSGNVSVRFRDGLLITPSGMPTDRTGPDDVVRL
DLDGAHPPDQKPSSEWRFHRDILASRPEFHAVVHAHPVYCTAFAMCGEAIPAVHYMIAAF
GGPTVRCAPYAPYGTAELSDLALAALVDRNVCLLANHGMIAAGASLEKALWLAVELETLC
QQYAVARQIGTPIILSDDEIGATVERFRGYGLNAARPTAPETT
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggacagagacgagcggatcgcgcgggagagcgtcgtggcggcggcgcgggcgctcgac
gcccaggggctgaaccgcggcacctcgggcaatgtctcggtgcgcttccgcgacgggctc
ctgatcaccccgtccggcatgcccactgaccggaccggaccggacgacgtggtccggttg
gacctcgacggcgcgcacccgccggaccagaagccctcgtcggaatggcgcttccaccgg
gacatcctggcgtcccgtccggaattccacgcggtggtccacgcgcatccggtctactgc
accgccttcgcgatgtgcggggaggccatcccggcggtccactacatgatcgcggccttc
ggcggcccgacagtgcgctgcgcgccctacgcgccgtacggcacggcggagctctcggac
ctcgccctcgcggcgctcgtcgaccgcaacgtctgcctcctcgccaaccacggcatgatc
gcggccggcgcgagcctggagaaggcgctgtggctcgccgtcgagctggaaacgctctgc
cagcaatacgccgtcgcgcggcagatcgggacgccgatcatcctgtccgacgacgagatc
ggcgccacggtcgagcgcttccgcggctacggtctgaacgcggcgcggccgaccgcgccg
gagacgacctga

DBGET integrated database retrieval system