KEGG   Methylobacterium radiotolerans: Mrad2831_2922Help
Entry
Mrad2831_2922     CDS       T00674                                 

Definition
glutathione S-transferase domain-containing protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mrad2831_2922
Enzymes [BR:mrd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Mrad2831_2922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3080775..3081398
Genome map
AA seq 207 aa AA seqDB search
MIIYGSSVSPYVRKVLVALYEKDVAFEHRPVGFHAPDPDFRAASPMGKIPAMEDAGYRLA
DSSAILDYLERQHPAPALIPEDARDAARARWFDKFGECELTRQVLVPFVERFLKPRLFKV
EGDEALAQRTVDTALPPLFDYLESQIGGPYLVGGRFGIADIAVAAPFHNLRLAKVAVDGA
RWPKLADWVAATLERPSFTAAIAAAKS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatcatctacggcagcagcgtgtcgccctacgtgcgcaaggtgctcgtggcgctctac
gagaaggacgtcgcgttcgagcatcgcccggtcggcttccacgcgccggatccggacttc
cgggccgcgagcccgatggggaagatccccgcgatggaggatgccgggtatcgcctcgcc
gattcgagcgcgatcctcgactatctcgagcggcagcatccggcgcccgcgctgatcccc
gaggacgcgcgggacgccgcccgcgcccgctggttcgacaagttcggcgagtgcgagctg
acccgccaggtgctcgtgccgttcgtcgagcgcttcctgaagccgcgcctgttcaaggtc
gagggcgacgaggcgctggcgcagcggaccgtcgacacggcgctgccgccgctgttcgac
tacctcgaatcgcagatcggcgggccctacctcgtcggcggccggttcggcatcgccgac
atcgccgtggcggcgccgttccacaacctgcggctggccaaggtcgcggtcgacggcgcc
cgctggccgaagctcgccgactgggtcgcggcgacgctcgagcggccgtccttcaccgcg
gcgatcgccgcggcgaagagctga

DBGET integrated database retrieval system