KEGG   Methylobacterium radiotolerans: Mrad2831_3145Help
Entry
Mrad2831_3145     CDS       T00674                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mrd  Methylobacterium radiotolerans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mrd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3326264..3326869
Genome map
AA seq 201 aa AA seqDB search
MPQAVAGPEIERLIQLLARMPGLGPRSARRAALQLIKKRDTLLGPLADAMRVAADRIVVC
TSCGNVDTSDPCTICRDAERDPTTLVVVEDVSDLWALERSGAVKARYHVLGGVLSALDGV
RPEHLNLASLVERVARPEVTEVILALNATVDGQTTAHYVTESIRHCDVKVTRLAHGVPVG
GELDYLDEGTLSAAIRSRTAF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgccccaagccgtcgccggccccgagatcgagcgcctgatccagctcctcgcccgcatg
ccgggcctcggaccgcgctcggcgcgccgggccgccctccagctcatcaagaagcgcgac
actttgctcgggcccctcgccgacgcgatgcgggtggcggccgaccgcatcgtcgtgtgc
acgagctgcgggaacgtcgacacctcggacccgtgcacgatctgccgcgacgccgagcgc
gatccgacgacgctcgtggtggtggaggacgtgtccgacctctgggccctggagcgctcc
ggggccgtgaaggcgcgctatcacgtgctcggcggcgtcctctcggcgctggacggcgtc
cggccggagcacctgaacctcgcgagtctcgtggagcgcgtggcccggcccgaggtcacc
gaggtcatcctggcgctcaacgccacggtcgacggccagaccaccgcccactacgtcacg
gagtcgatccggcactgcgacgtgaaggtcacgcgcctcgcccacggcgtgccggtcggc
ggcgagctcgactacctcgacgagggcacgctgtcggcggcgatccgcagccggacggcg
ttctga

DBGET integrated database retrieval system