KEGG   Methylobacterium radiotolerans: Mrad2831_3149Help
Entry
Mrad2831_3149     CDS       T00674                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00300  Lysine biosynthesis
mrd01100  Metabolic pathways
mrd01120  Microbial metabolism in diverse environments
mrd01230  Biosynthesis of amino acids
Module
mrd_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Mrad2831_3149
Enzymes [BR:mrd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Mrad2831_3149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ACB25131
JGI: Mrad28313149
UniProt: B1M6P0
Position
complement(3329180..3330358)
Genome map
AA seq 392 aa AA seqDB search
MPADHHAPDAALRLAQDLIRCPSVTPEDRGALDVVADALRPAGFAIERPVFAEPGYPDTP
NLYARIGQNGPCLVFAGHTDVVPEGEGAWRHDPFAGAVADGMLYGRGAADMKGGVACMLA
ATLAFLDRRGADFGGSIAFLITGDEEGPAVNGTVKLLDWARRRGERFDHCVLGEPTNPGR
LGEMIKIGRRGSLTGKLTVLGRQGHVAYPHKAENPIPGLLRLASALIAEPLDRGTAHFDA
SNLEFTTVDVGNPATNVIPSTARATFNVRFNDDWTAESLGAEIRRRLEQAAGNAVRFTLD
LQPSNAPAFLTRPDAFVTLVAEAIRAETGLTPTLSTTGGTSDARFIKDACPVIEFGLVGE
TMHQVDECVAVADLERLTAIYGRVLDAYFPGS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgccggctgaccatcacgcccccgacgcggccctgcgcctcgcgcaggacctgatccgc
tgtccgtccgtgacaccggaagatcggggcgccctcgacgtggtcgccgacgcgctccgg
ccggccggcttcgcgatcgagcggccggtcttcgcggagcccggctatcccgatacgccg
aacctctacgcccgcatcgggcagaacggtccgtgcctcgtctttgccggccacaccgac
gtcgtgccggagggcgagggcgcctggcgccacgatcccttcgcgggcgccgtggccgac
gggatgctgtacggccggggcgcggccgacatgaagggcggcgtcgcctgcatgctcgcg
gcgaccctcgccttcctcgaccggcgcggggccgatttcggcggctccatcgcgtttctg
atcaccggcgacgaggagggacccgcggtcaacggcaccgtgaagctcctcgactgggcg
cggcgccgcggcgagcgattcgaccattgcgtgctcggggagccgaccaacccgggccgg
ctcggcgagatgatcaagatcggccggcgcgggtcgctgaccggcaagctcaccgtgctc
gggcggcagggccacgtcgcctacccgcacaaggccgaaaacccgattcccggcctgctg
cgcctcgcctcggcgctgatcgccgagcctctggatcgtgggaccgcgcatttcgacgcc
tcgaacctcgaattcaccacggtcgacgtcggcaatccagccaccaacgtgatcccgtcg
accgcccgggcaaccttcaacgtccgcttcaacgacgactggacggccgagagcctgggc
gccgagatccgccggcgcctggagcaggcggccgggaacgcggtccgcttcaccctcgac
ctccagccctcgaacgcgccggccttcctgacgcggccggacgccttcgtgacgctcgtc
gccgaggcgatccgggccgagaccggtctgacgccgacgctctccaccaccggcggcacg
tcggacgcgcgcttcatcaaggatgcctgcccggtgatcgagttcggcctcgtcggcgag
acgatgcaccaggtcgacgaatgcgtggcggtcgccgacctcgagcggctgaccgcgatc
tacgggcgcgtgctcgacgcctatttcccgggatcgtag

DBGET integrated database retrieval system