KEGG   Methylobacterium radiotolerans: Mrad2831_3588Help
Entry
Mrad2831_3588     CDS       T00674                                 

Definition
PAS/PAC sensor signal transduction histidine kinase (EC:2.7.13.3)
Orthology
K07636  
two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC:2.7.13.3]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Two-component system
Module
PhoR-PhoB (phosphate starvation response) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mrad2831_3588
Enzymes [BR:mrd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Mrad2831_3588
Protein kinases [BR:mrd01001]
 Histidine protein kinases
  OmpR family
   Mrad2831_3588
Two-component system [BR:mrd02022]
 OmpR family
  PhoR-PhoB (phosphate) [MD:M00434]
   Mrad2831_3588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3813963..3815234)
Genome map
AA seq 423 aa AA seqDB search
MSGRLRSSPAWTGAAIAAGLLGLATALAGRLDLPLILIGLAAVCLGGWLGGRGREAPVAR
PAAATPRHAVAEALLAHVPDPVILVDRRTLVLEANPAARALLPALHQARPLSFALRDPEV
LDGIEAVLSSGLPRRVALSTRVPLERTFEVQIGALPMPDGSGVSALLFLRDLTSARRLEA
MRVDFVANASHELRTPLATLIGFIETLQGPARDDAQARERFLEIMRVQAQRMTRLIDDLL
SLSRIELREHVAPTAVVDLGALARQMVDAQGLPAEARGATIRLEEGAGPYAVPGDADELA
RVIENLIENAVKYGGGRISVGLAREDDPRLGRRVVLSVADDGPGIPPEHIPRLTERFYRV
DVASSRARGGTGLGLAIVKHSLNRHRGRLAIESAAGEGTTVRVSLPEYGAAPPQAAADQA
GPA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtccggccgcctgcgcagctcccccgcctggaccggcgccgcgatcgccgcgggcctg
ctcgggctcgccacggccctggccgggcggctcgacctcccgctgatcctgatcgggctc
gcggcggtctgcctgggcggctggctcggcgggcgcggccgcgaggcccccgtcgcgcga
ccggccgccgccacgccgcgccacgccgtcgccgaggcgctgctcgcccacgtgccggac
ccggtcatcctcgtggaccggcgcaccctggtgctggaggccaatcccgccgcccgggcg
ctgctgccggcgctccatcaggcccggcccctgtccttcgcgctccgcgacccggaggtc
ctcgacggcatcgaggcggtgctgagttccggcctcccgcgccgggtcgcgctgtcgacc
cgggtgccgctggagcggaccttcgaggtccagatcggcgcgctgccgatgcccgacggg
tccggcgtgagcgcgctgctgttcctgcgcgacctcacctcggcccggcgtctcgaggcg
atgcgggtcgatttcgtcgccaacgcgagccacgagctgcgcacgccgctcgccaccctg
atcggcttcatcgagaccctgcagggtccggcccgcgacgacgcgcaggcccgggagcgc
ttcctggagatcatgcgcgtccaggcccagcggatgacgcggctgatcgacgacctgctg
tcgctgtcgcggatcgagctgcgcgagcacgtggcgcccaccgcggtggtcgatctcggg
gcgctcgcccgccagatggtcgacgcccagggcctgcccgccgaggcgcggggcgccacg
atccgactggaggagggggcgggcccctacgcggtccccggcgacgccgacgagctcgcc
cgggtgatcgagaacctgatcgagaacgccgtgaagtacggcggcggccggatcagcgtc
gggctcgcccgcgaggacgacccgcgcctcgggcgccgcgtcgtcctgtcggtggccgac
gacgggccgggcatcccgcccgagcacatcccgcggctgacggagcgcttctaccgggtc
gacgtcgcgtcgagccgcgcccgcggcggcacgggcctcgggctcgccatcgtcaagcac
agcctcaaccgccaccgcgggcggctcgccatcgagagcgcggccggggagggcacgacc
gtgcgggtcagcctgccggaatacggcgccgcgccgccgcaggccgcggccgatcaggcc
ggcccggcgtag

DBGET integrated database retrieval system