KEGG   Methylobacterium radiotolerans: Mrad2831_3588Help
Entry
Mrad2831_3588     CDS       T00674                                 

Definition
PAS/PAC sensor signal transduction histidine kinase (EC:2.7.13.3)
Orthology
K07636  
two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC:2.7.13.3]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Two-component system
Module
PhoR-PhoB (phosphate starvation response) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mrd02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3813963..3815234)
Genome map
AA seq 423 aa AA seqDB search
MSGRLRSSPAWTGAAIAAGLLGLATALAGRLDLPLILIGLAAVCLGGWLGGRGREAPVAR
PAAATPRHAVAEALLAHVPDPVILVDRRTLVLEANPAARALLPALHQARPLSFALRDPEV
LDGIEAVLSSGLPRRVALSTRVPLERTFEVQIGALPMPDGSGVSALLFLRDLTSARRLEA
MRVDFVANASHELRTPLATLIGFIETLQGPARDDAQARERFLEIMRVQAQRMTRLIDDLL
SLSRIELREHVAPTAVVDLGALARQMVDAQGLPAEARGATIRLEEGAGPYAVPGDADELA
RVIENLIENAVKYGGGRISVGLAREDDPRLGRRVVLSVADDGPGIPPEHIPRLTERFYRV
DVASSRARGGTGLGLAIVKHSLNRHRGRLAIESAAGEGTTVRVSLPEYGAAPPQAAADQA
GPA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtccggccgcctgcgcagctcccccgcctggaccggcgccgcgatcgccgcgggcctg
ctcgggctcgccacggccctggccgggcggctcgacctcccgctgatcctgatcgggctc
gcggcggtctgcctgggcggctggctcggcgggcgcggccgcgaggcccccgtcgcgcga
ccggccgccgccacgccgcgccacgccgtcgccgaggcgctgctcgcccacgtgccggac
ccggtcatcctcgtggaccggcgcaccctggtgctggaggccaatcccgccgcccgggcg
ctgctgccggcgctccatcaggcccggcccctgtccttcgcgctccgcgacccggaggtc
ctcgacggcatcgaggcggtgctgagttccggcctcccgcgccgggtcgcgctgtcgacc
cgggtgccgctggagcggaccttcgaggtccagatcggcgcgctgccgatgcccgacggg
tccggcgtgagcgcgctgctgttcctgcgcgacctcacctcggcccggcgtctcgaggcg
atgcgggtcgatttcgtcgccaacgcgagccacgagctgcgcacgccgctcgccaccctg
atcggcttcatcgagaccctgcagggtccggcccgcgacgacgcgcaggcccgggagcgc
ttcctggagatcatgcgcgtccaggcccagcggatgacgcggctgatcgacgacctgctg
tcgctgtcgcggatcgagctgcgcgagcacgtggcgcccaccgcggtggtcgatctcggg
gcgctcgcccgccagatggtcgacgcccagggcctgcccgccgaggcgcggggcgccacg
atccgactggaggagggggcgggcccctacgcggtccccggcgacgccgacgagctcgcc
cgggtgatcgagaacctgatcgagaacgccgtgaagtacggcggcggccggatcagcgtc
gggctcgcccgcgaggacgacccgcgcctcgggcgccgcgtcgtcctgtcggtggccgac
gacgggccgggcatcccgcccgagcacatcccgcggctgacggagcgcttctaccgggtc
gacgtcgcgtcgagccgcgcccgcggcggcacgggcctcgggctcgccatcgtcaagcac
agcctcaaccgccaccgcgggcggctcgccatcgagagcgcggccggggagggcacgacc
gtgcgggtcagcctgccggaatacggcgccgcgccgccgcaggccgcggccgatcaggcc
ggcccggcgtag

DBGET integrated database retrieval system