KEGG   Methylobacterium radiotolerans: Mrad2831_3892Help
Entry
Mrad2831_3892     CDS       T00674                                 

Definition
dihydrofolate reductase
Orthology
K17364  
dihydromethanopterin reductase [EC:1.5.1.47]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mrad2831_3892
Enzymes [BR:mrd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.47  dihydromethanopterin reductase
     Mrad2831_3892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4139458..4139868)
Genome map
AA seq 136 aa AA seqDB search
MIDVRCICAIGLRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPE
FAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYARYIQNWDITRLPYDGEAD
RWFDPAWLVGGPLRTP
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgtccgctgcatctgcgcgatcggcctgcggggccagctcggcctcaacggc
cacctgccctgggagggcaacaccgacccgctcttcgtggaggacgtgacgcgcttcttc
gccctgaccatgggccacgtgctgatcgccgggccgaagacggtggcctcggtgccggaa
ttcgccttcaaggaccgcaccatcgacgtgatccgcagccacgaggatccggaggcagtg
ctcaagcgctatcccggacggcggatcttcgtcggcggcgggatcgcggtgtggaacgtc
tacgcccggtacatccagaactgggacatcacgcgcctgccctacgacggcgaggccgac
cgctggttcgatcccgcttggctggtcggcgggccgctgcggacgccctga

DBGET integrated database retrieval system