KEGG   Methylobacterium radiotolerans: Mrad2831_3923Help
Entry
Mrad2831_3923     CDS       T00674                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mrad2831_3923
Enzymes [BR:mrd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mrad2831_3923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4173658..4174986)
Genome map
AA seq 442 aa AA seqDB search
MPLPQERLPQERLPQETIRAKRDGQPLEPEAIDAFIRGLTDGTVGEGQAAAFAMAVFFRG
LSLPERVALTRAMAESGRVLAWDLPGPVLDKHSTGGIGDAVSLPLAPMVAACGGYVPMIS
GRGLGHTGGTLDKLGSIPGYDATPGLDAFRRVVGTVGCAIIGQTAELAPADRRLYAIRDV
TGTVESRDLITASILSKKLAAGLDGLVMDVKQGSGAFMATLPEARALAGSIVTVAEGAGL
HTAALITDMDAPLASAAGNAVEVAYAIDYLTGARREPRFHAVTVALGAEMLVVGGLAPDR
DSAAERLERALASGRAAEGFGRMVAALGGPGDLLERPAAHLPAAPVRRAVRQDGTVAGIA
TRALGLAVIGLGGGRTRPEDPVDPRVGFTDLAGPGSSGGLLGIVHAADEAAADRAEAALR
AAYRMGDAPTERPPVLERVDAG
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcttccccaggagaggcttccccaggagaggctgccccaggagacgatccgggcc
aagcgcgacggccagcccctcgagccggaggcgatcgacgccttcatccgcggcctcacc
gacggcacggtcggggagggtcaggcggcggccttcgccatggcggtgttcttccgcggc
ctgtcgctgccggagcgggtggcgctgacccgggccatggccgagtcgggccgggtcctc
gcctgggacctgcccgggcccgtcctcgacaagcactccaccggcggcatcggcgacgcg
gtgagcctgccgctcgccccgatggtcgcggcctgcggcggctacgtgccgatgatctcg
gggcgcggcctcggccataccggcgggacgctggacaagctcggcagcatcccgggctac
gacgcgacgccgggcctcgacgcgttccgccgggtcgtcggcacggtcggctgcgccatc
atcggccagactgccgagctcgcgcccgcggaccggcgcctctacgcgatccgcgacgtc
accggcacggtcgagtcccgcgacctgatcaccgcctcgatcctgtcgaagaagctcgcc
gccgggctggacgggctcgtgatggacgtgaagcagggctccggcgccttcatggcaacg
ctgcccgaggcgcgcgccctggcggggagcatcgtcacggtggcggagggggccggcctg
cacaccgccgcgctgatcaccgacatggacgcgccgctcgccagcgcggccggcaacgcc
gtcgaggtcgcctacgcgatcgactacctgacgggcgcgcgccgcgagccgcgcttccac
gcggtcacggtggccctgggcgcggagatgctggtcgtcggcggcctcgcgccggaccgc
gacagcgccgcggagcggctggagcgggccctcgcgtcgggccgggcggccgagggcttc
ggccgcatggtcgcggccctgggcgggccgggcgatctcctggagcggccggcggcgcat
ctgccggcggcaccggtgcgccgggcggtgcgtcaggacgggaccgtcgcggggatcgcg
acgcgggcgctgggcctggcggtgatcggactcgggggcggacgcacgcggccggaggat
cccgtcgacccgcgcgtcggcttcacggacctcgccggtccgggatcgtccggcggcctg
ctcgggatcgtccacgcggccgacgaggccgccgcggaccgggccgaggccgcgctgcgg
gcggcctaccggatgggcgacgcgccgacggagcggccgcccgtcctggagcgggtggac
gccggttag

DBGET integrated database retrieval system