KEGG   Methylobacterium radiotolerans: Mrad2831_4038Help
Entry
Mrad2831_4038     CDS       T00674                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mrd00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4284992..4285864
Genome map
AA seq 290 aa AA seqDB search
MTGAATISGPERERIAAALAEIACAAGEILRRYHRGPCPHALKPDGSPSSAADVEAEDLI
VEALAGRFPGIAVVAEERAQGDATRPADLFFLVDPLDGTRDFLAGTPDYSVNIALVSGAR
PVAAALAAPGLGRVWWAGPATLEGPVVAGRPGAGRPVRARPVPVAGLVALGSRRHGDPET
ATCLAALPVAETRQVGSALKFALIAAGEADIYVRCGPTMEWDTAAGDHIVAAAGGRVVVP
GGGPIRYGQHGPDHRNGPFAALGDPTLAPRLALPARAAGRPAAPLSAARP
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcgcggcgacgatctcggggccggagcgtgagcggatcgccgcggcgctcgcc
gagatcgcctgcgcggcgggggagatcctgcgccgctaccaccggggcccctgccctcac
gccctgaagccggacggctccccctccagcgccgccgacgtcgaggccgaggacctgatc
gtcgaggccctcgccgggcgcttcccgggaatcgcggtcgtggccgaggagcgcgcccag
ggcgacgcgacccgcccggccgacctcttcttcctcgtcgaccccctggacggcacccgc
gacttcctcgccgggacgccggactactcggtcaacatcgcgctcgtgtccggcgcccgc
ccggtggcggccgccctcgcggcccccggtctcggccgggtctggtgggccggccccgcg
accctggagggtcctgtggtcgcgggccggccgggggccgggcggccggtccgcgcgcgg
ccggtgccggtggcgggcctcgtcgccctgggcagccggcggcacggcgatcccgagacc
gccacctgcctcgccgcgctgccggtcgcggagacgcgccaggtcgggtccgccctgaag
ttcgcgctgatcgccgccggcgaggcggacatctacgtccgctgcggcccgaccatggaa
tgggatacggccgcgggcgaccacatcgtcgcggcggcggggggccgggtggtggtgccg
ggcggcggcccgatccgctacggccagcacgggcccgatcaccgcaacggtcccttcgcg
gccctcggggacccgaccctggccccgcggctcgccctgccggcccgcgcggccggccgg
ccggcggcgccgctcagcgcggcgcgtccgtag

DBGET integrated database retrieval system