KEGG   Methylobacterium radiotolerans: Mrad2831_4038Help
Entry
Mrad2831_4038     CDS       T00674                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Mrad2831_4038
Enzymes [BR:mrd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Mrad2831_4038
Transfer RNA biogenesis [BR:mrd03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Mrad2831_4038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4284992..4285864
Genome map
AA seq 290 aa AA seqDB search
MTGAATISGPERERIAAALAEIACAAGEILRRYHRGPCPHALKPDGSPSSAADVEAEDLI
VEALAGRFPGIAVVAEERAQGDATRPADLFFLVDPLDGTRDFLAGTPDYSVNIALVSGAR
PVAAALAAPGLGRVWWAGPATLEGPVVAGRPGAGRPVRARPVPVAGLVALGSRRHGDPET
ATCLAALPVAETRQVGSALKFALIAAGEADIYVRCGPTMEWDTAAGDHIVAAAGGRVVVP
GGGPIRYGQHGPDHRNGPFAALGDPTLAPRLALPARAAGRPAAPLSAARP
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcgcggcgacgatctcggggccggagcgtgagcggatcgccgcggcgctcgcc
gagatcgcctgcgcggcgggggagatcctgcgccgctaccaccggggcccctgccctcac
gccctgaagccggacggctccccctccagcgccgccgacgtcgaggccgaggacctgatc
gtcgaggccctcgccgggcgcttcccgggaatcgcggtcgtggccgaggagcgcgcccag
ggcgacgcgacccgcccggccgacctcttcttcctcgtcgaccccctggacggcacccgc
gacttcctcgccgggacgccggactactcggtcaacatcgcgctcgtgtccggcgcccgc
ccggtggcggccgccctcgcggcccccggtctcggccgggtctggtgggccggccccgcg
accctggagggtcctgtggtcgcgggccggccgggggccgggcggccggtccgcgcgcgg
ccggtgccggtggcgggcctcgtcgccctgggcagccggcggcacggcgatcccgagacc
gccacctgcctcgccgcgctgccggtcgcggagacgcgccaggtcgggtccgccctgaag
ttcgcgctgatcgccgccggcgaggcggacatctacgtccgctgcggcccgaccatggaa
tgggatacggccgcgggcgaccacatcgtcgcggcggcggggggccgggtggtggtgccg
ggcggcggcccgatccgctacggccagcacgggcccgatcaccgcaacggtcccttcgcg
gccctcggggacccgaccctggccccgcggctcgccctgccggcccgcgcggccggccgg
ccggcggcgccgctcagcgcggcgcgtccgtag

DBGET integrated database retrieval system