KEGG   Methylobacterium radiotolerans: Mrad2831_4820Help
Entry
Mrad2831_4820     CDS       T00674                                 

Definition
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd02020  Two-component system
mrd02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mrad2831_4820
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mrad2831_4820
Enzymes [BR:mrd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mrad2831_4820
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Mrad2831_4820
Two-component system [BR:mrd02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Mrad2831_4820
Bacterial motility proteins [BR:mrd02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mrad2831_4820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ACB26780
JGI: Mrad28314820
UniProt: B1M859
Position
5148123..5149208
Genome map
AA seq 361 aa AA seqDB search
MSASRPIRVLVVDDSASVRQTLCSILETAPDIEILGTAADPFIAARRIQEEIPDVIILDL
EMPRMDGLTFLRKIMAQKPLPVIVCSTLTGAGSRMLFEVLEAGAVDVLPKPRVDTRQFLL
ESTVRVCDAVRAAARAKLRGSRPPRQLVEAKLSADAVLPPPVPGRVVVETDRIVCIGAST
GGTEALRDVLEVLPAESPGLVIVQHMPEHFTAAFAKRLNGLCAITVKEAEDGDPVMRGRA
LIAPGGRHLMVERRGGSYAVSVKDGPLVARHRPSVDVLFRSAARAAAANALGILLTGMGD
DGANGLLEMRRAGAQTVAQDEASCVVFGMPKEAIDRGAAAKVLPLEQMHLEIRRFGLSAA
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgtcccgaccgatccgcgtcctcgtggtcgacgactcggcctccgtccgccag
accctgtgcagcatcctggagacggcgcccgacatcgagatcctgggaacggccgccgat
ccgttcatcgccgcccgccggatccaggaggagatcccggacgtcatcatcctcgatctc
gagatgccccgcatggacggactgaccttcctgcggaagatcatggcgcagaagccgctc
ccggtgatcgtctgctcgaccctgaccggggcgggctcccggatgctgttcgaggtcctg
gaggcgggggccgtcgacgtgctgccgaagccgcgggtcgacacgcgtcagttcctgctc
gagtccaccgtccgggtctgcgacgcggtccgggcggccgcgcgggccaagctgcgcggg
agccggccgccccggcagctggtcgaggcgaagctctcggccgacgccgtcctgccgccg
cccgtccccggtcgcgtggtggtcgagaccgaccggatcgtctgcatcggcgcgtcgacg
ggtgggacggaggccctgcgcgacgtgctcgaggtgctgcccgccgagtcccccggcctc
gtcatcgtgcagcacatgccggagcatttcacggcggcgttcgccaagcgcctgaacggc
ctctgcgcgatcaccgtcaaggaggcggaggacggcgatcccgtgatgcggggccgcgcc
ctgatcgcccccggcgggcgtcacctcatggtcgagcgccggggcggcagctacgcggtg
tcggtgaaggatggtcctctcgtcgcgcgccatcgcccgtcggtcgacgtcctgttccgg
tcggccgcccgggcggcggccgcgaacgccctcggcatcctcctgaccggaatgggcgac
gacggcgccaatggcctgctggagatgcgccgggccggagcgcagacggtcgcacaggac
gaggcgagctgcgtcgtgttcgggatgcccaaggaagcgatcgaccgcggcgcggccgcc
aaggtcctgccgctcgagcagatgcacctggagatccggcgcttcggcctgtccgcggcg
cgctga

DBGET integrated database retrieval system