KEGG   Methylobacterium radiotolerans: Mrad2831_4820Help
Entry
Mrad2831_4820     CDS       T00674                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mrd02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mrd02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5148123..5149208
Genome map
AA seq 361 aa AA seqDB search
MSASRPIRVLVVDDSASVRQTLCSILETAPDIEILGTAADPFIAARRIQEEIPDVIILDL
EMPRMDGLTFLRKIMAQKPLPVIVCSTLTGAGSRMLFEVLEAGAVDVLPKPRVDTRQFLL
ESTVRVCDAVRAAARAKLRGSRPPRQLVEAKLSADAVLPPPVPGRVVVETDRIVCIGAST
GGTEALRDVLEVLPAESPGLVIVQHMPEHFTAAFAKRLNGLCAITVKEAEDGDPVMRGRA
LIAPGGRHLMVERRGGSYAVSVKDGPLVARHRPSVDVLFRSAARAAAANALGILLTGMGD
DGANGLLEMRRAGAQTVAQDEASCVVFGMPKEAIDRGAAAKVLPLEQMHLEIRRFGLSAA
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgtcccgaccgatccgcgtcctcgtggtcgacgactcggcctccgtccgccag
accctgtgcagcatcctggagacggcgcccgacatcgagatcctgggaacggccgccgat
ccgttcatcgccgcccgccggatccaggaggagatcccggacgtcatcatcctcgatctc
gagatgccccgcatggacggactgaccttcctgcggaagatcatggcgcagaagccgctc
ccggtgatcgtctgctcgaccctgaccggggcgggctcccggatgctgttcgaggtcctg
gaggcgggggccgtcgacgtgctgccgaagccgcgggtcgacacgcgtcagttcctgctc
gagtccaccgtccgggtctgcgacgcggtccgggcggccgcgcgggccaagctgcgcggg
agccggccgccccggcagctggtcgaggcgaagctctcggccgacgccgtcctgccgccg
cccgtccccggtcgcgtggtggtcgagaccgaccggatcgtctgcatcggcgcgtcgacg
ggtgggacggaggccctgcgcgacgtgctcgaggtgctgcccgccgagtcccccggcctc
gtcatcgtgcagcacatgccggagcatttcacggcggcgttcgccaagcgcctgaacggc
ctctgcgcgatcaccgtcaaggaggcggaggacggcgatcccgtgatgcggggccgcgcc
ctgatcgcccccggcgggcgtcacctcatggtcgagcgccggggcggcagctacgcggtg
tcggtgaaggatggtcctctcgtcgcgcgccatcgcccgtcggtcgacgtcctgttccgg
tcggccgcccgggcggcggccgcgaacgccctcggcatcctcctgaccggaatgggcgac
gacggcgccaatggcctgctggagatgcgccgggccggagcgcagacggtcgcacaggac
gaggcgagctgcgtcgtgttcgggatgcccaaggaagcgatcgaccgcggcgcggccgcc
aaggtcctgccgctcgagcagatgcacctggagatccggcgcttcggcctgtccgcggcg
cgctga

DBGET integrated database retrieval system